Property Summary

NCBI Gene PubMed Count 20
Grant Count 20
R01 Count 10
Funding $2,154,683.5
PubMed Score 94.38
PubTator Score 91.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.830 0.001
interstitial cystitis -5.200 0.000
nasopharyngeal carcinoma -2.200 0.018
non-inflammatory breast cancer -3.300 0.005
spina bifida -1.704 0.027
pituitary cancer -1.900 0.000
pancreatic cancer -1.700 0.001
psoriasis -1.300 0.000

Gene RIF (10)

PMID Text
26123584 in-vitro and in-vivo glucose is a potent stimulator of the PANDER promoter within the liver and this response may be facilitated by ChREBP.
24468680 beta-cell-secreted PANDER regulated the hepatic insulin and lipogenenic signaling and impact overall glycemia.
23855304 It is an important regulator of glucose and lipid metabolism and plays a role in the pathogenesis of nonalcoholic fatty liver disease.(review)
23246487 our studies demonstrated that silencing FAM3B promoted p53 phosphorylation and induced p53 accumulation by decreasing Mdm2 expression, which resulted in apoptotic cell death.
23059759 These results suggest that FAM3B-258 promotes colon cancer cell invasion and metastasis through upregulation of Slug.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
16249448 PANDER is secreted from 2 types of pancreatic cells, glucose stimulates its secretion in beta cell and primary islets but not in alpha-cells, it is likely cosecreted with insulin, and structure and conformation is vital for PANDER secretion.
16114871 Helices B and C and the second disulfide bond of PANDER are essential for PANDER-induced beta-cell death.
12160727 Localized to the islets of Langerhans.

AA Sequence

MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP      1 - 70
SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK     71 - 140
FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS    141 - 210
DAKNNRYSGWPAEIQIEGCIPKERS                                                 211 - 235
//

Text Mined References (20)

PMID Year Title
26123584 2015 Hepatic nutrient and hormonal regulation of the PANcreatic-DERived factor (PANDER) promoter.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24468680 2014 PANDER transgenic mice display fasting hyperglycemia and hepatic insulin resistance.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23855304 2013 Family with sequence similarity 3 gene family and nonalcoholic fatty liver disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
23246487 2013 Knockdown of FAM3B triggers cell apoptosis through p53-dependent pathway.
23059759 2013 A non-secretory form of FAM3B promotes invasion and metastasis of human colon cancer cells by upregulating Slug expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...