Property Summary

NCBI Gene PubMed Count 28
PubMed Score 26.74
PubTator Score 49.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 1.3e-06
aldosterone-producing adenoma 665 1.9e-02
Disease Target Count Z-score Confidence
Usher syndrome 32 6.869 3.4
Disease Target Count Z-score Confidence
Perrault syndrome 19 3.49 1.7
Blindness 88 3.044 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma 2.360 1.9e-02
ovarian cancer -1.500 1.3e-06

Gene RIF (15)

AA Sequence

MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGEMQYGLFHGEG      1 - 70
VRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLL     71 - 140
SFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAG    141 - 210
FQFPFAKSKDAETTNVAADLMY                                                    211 - 232
//

Text Mined References (29)

PMID Year Title