Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
Funding $1,155,707.67
PubMed Score 11.17
PubTator Score 23.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -3.100 0.000
medulloblastoma -3.300 0.001
atypical teratoid / rhabdoid tumor -2.900 0.007
glioblastoma -2.700 0.025
medulloblastoma, large-cell -4.400 0.000
adrenocortical carcinoma -3.627 0.000
pilocytic astrocytoma 1.800 0.004
aldosterone-producing adenoma -2.311 0.027
Pick disease -1.100 0.010
ductal carcinoma in situ 2.600 0.046
invasive ductal carcinoma 1.900 0.043
psoriasis -2.100 0.000

Gene RIF (12)

PMID Text
26410934 The role of NXPH1 in in paranoid schizophrenia development in Russians.
24041540 Rs2349775 (NXPH1) and rs17837965 (CDC42) were associated with diarrhoea and constipation predominant irritable bowel syndrome, respectively, in two independent cohorts.
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
21628410 results demonstrate the presence and function of a regulated signaling axis in hematopoiesis centered on NRXN1alpha and its modulation by DAG1 and NXPH1
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20100581 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDT      1 - 70
DLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGK     71 - 140
IVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLC    141 - 210
NYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG             211 - 271
//

Text Mined References (26)

PMID Year Title
26410934 2015 [The Role of Neurotrophins and Neurexins Genes in the Risk of Paranoid Schizophrenia in Russians and Tatars].
24041540 2014 Genetic variants in CDC42 and NXPH1 as susceptibility factors for constipation and diarrhoea predominant irritable bowel syndrome.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
22890011 2012 Genome-wide association study indicates variants associated with insulin signaling and inflammation mediate lipoprotein responses to fenofibrate.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21628410 2011 Neurexophilin 1 suppresses the proliferation of hematopoietic progenitor cells.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
More...