Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.38
PubTator Score 23.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -3.627 9.2e-06
aldosterone-producing adenoma -2.311 2.7e-02
Astrocytoma, Pilocytic 1.800 4.3e-03
atypical teratoid / rhabdoid tumor -2.900 6.8e-03
ductal carcinoma in situ 2.600 4.6e-02
ependymoma -3.100 4.4e-08
glioblastoma -2.700 2.5e-02
group 3 medulloblastoma -1.900 4.0e-02
invasive ductal carcinoma 1.900 4.3e-02
medulloblastoma, large-cell -4.400 7.2e-07
Pick disease -1.100 1.0e-02
psoriasis -2.100 1.1e-04

Gene RIF (15)

AA Sequence

MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDT      1 - 70
DLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGK     71 - 140
IVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLC    141 - 210
NYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG             211 - 271
//

Text Mined References (29)

PMID Year Title