Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.17
PubTator Score 5.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P58401
Symbols

Gene

PDB

4NXR  

Gene RIF (5)

PMID Text
25450229 The rare variants in NRXN2 were significantly associated with smoking status.
21424692 Truncating mutations in NRXN2 is associated with autism spectrum disorders and schizophrenia
20634891 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFHSKH      1 - 70
GTVPIAINRMPFLTRGGHAGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASG     71 - 140
LGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFD    141 - 210
NERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAE    211 - 280
SDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDL    281 - 350
LVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFVPPPPTFYPFLTGVGATQDTLPPP    351 - 420
AARRPPSGGPCQAERDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRP    421 - 490
NLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGF    491 - 560
PHLPTANPTGPGERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNY    561 - 630
ISNSAQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV                                      631 - 666
//

Text Mined References (25)

PMID Year Title
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
21768215 2011 Genome-wide association study for serum urate concentrations and gout among African Americans identifies genomic risk loci and a novel URAT1 loss-of-function allele.
21424692 2011 Truncating mutations in NRXN2 and NRXN1 in autism spectrum disorders and schizophrenia.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18923512 2008 Neuroligins and neurexins link synaptic function to cognitive disease.
More...