Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
Funding $99,408.08
PubMed Score 21.28
PubTator Score 22.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (15)

PMID Text
24876675 ADAMTS-12 is a multifaced metalloproteinase in arthritis and inflammation [review]
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of ADAM metallopeptidase with thrombospondin type 1 motif, 12 (ADAMTS12) in primary human brain microvascular endothelial cells
23019333 ADAMTS-12 is implicated in the inflammatory response by modulating normal neutrophil apoptosis.
22505177 Our results suggest that ADAMTS12 may be a susceptibility gene for RA development.
22322903 The data supported the hypothesis that genetic variations in ADAMTS12 influence the risk of schizophrenia.
22247065 statistically significant increase in mRNA expression of ADAMTS-7 and ADAMTS-12 was observed in the endplate cells in degenerative discs compared with nondegenerative discs
21559743 expression of ADAMTS12 in colorectal cancer stroma plays an important role in inhibiting tumor development
21494557 This study identifies a novel biological role for ADAMTS-12, and highlights the importance and complexity of its non-proteolytic domain(s) pertaining to its function.
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYG      1 - 70
LHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCH     71 - 140
LSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGL    141 - 210
KDSVNISQKQELWREKWERHNLPSRSLSRRSISKERWVETLVVADTKMIEYHGSENVESYILTIMNMVTG    211 - 280
LFHNPSIGNAIHIVVVRLILLEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDI    281 - 350
CAGFNRPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHPYIMS    351 - 420
RQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQLQYGPNATFCQ    421 - 490
EVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPESIPGGWGRWSPWSHCSRTCGA    491 - 560
GVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSEAPTFRQMQCSEFDTVPYKNELYHWFPIFNPA    561 - 630
HPCELYCRPIDGQFSEKMLDAVIDGTPCFEGGNSRNVCINGICKMVGCDYEIDSNATEDRCGVCLGDGSS    631 - 700
CQTVRKMFKQKEGSGYVDIGLIPKGARDIRVMEIEGAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGT    701 - 770
VFQYDRKGDLEKLMATGPTNESVWIQLLFQVTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGHWTECSVTC    771 - 840
GTGIRRQTAHCIKKGRGMVKATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGPHGEKKRTVLC    841 - 910
IQTMVSDEQALPPTDCQHLLKPKTLLSCNRDILCPSDWTVGNWSECSVSCGGGVRIRSVTCAKNHDEPCD    911 - 980
VTRKPNSRALCGLQQCPSSRRVLKPNKGTISNGKNPPTLKPVPPPTSRPRMLTTPTGPESMSTSTPAISS    981 - 1050
PSPTTASKEGDLGGKQWQDSSTQPELSSRYLISTGSTSQPILTSQSLSIQPSEENVSSSDTGPTSEGGLV   1051 - 1120
ATTTSGSGLSSSRNPITWPVTPFYNTLTKGPEMEIHSGSGEEREQPEDKDESNPVIWTKIRVPGNDAPVE   1121 - 1190
STEMPLAPPLTPDLSRESWWPPFSTVMEGLLPSQRPTTSETGTPRVEGMVTEKPANTLLPLGGDHQPEPS   1191 - 1260
GKTANRNHLKLPNNMNQTKSSEPVLTEEDATSLITEGFLLNASNYKQLTNGHGSAHWIVGNWSECSTTCG   1261 - 1330
LGAYWRRVECSTQMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCSRNCSGGFKIREIQCVDSRDHRNL   1331 - 1400
RPFHCQFLAGIPPPLSMSCNPEPCEAWQVEPWSQCSRSCGGGVQERGVFCPGGLCDWTKRPTSTMSCNEH   1401 - 1470
LCCHWATGNWDLCSTSCGGGFQKRTVQCVPSEGNKTEDQDQCLCDHKPRPPEFKKCNQQACKKSADLLCT   1471 - 1540
KDKLSASFCQTLKAMKKCSVPTVRAECCFSCPQTHITHTQRQRRQRLLQKSKEL                   1541 - 1594
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24876675 2014 ADAMTS-12: a multifaced metalloproteinase in arthritis and inflammation.
23019333 2012 ADAMTS-12 metalloprotease is necessary for normal inflammatory response.
22990015 2012 A genome-wide association study identifies a gene network of ADAMTS genes in the predisposition to pediatric stroke.
22505177 2012 Association of ADAMTS12 polymorphisms with rheumatoid arthritis.
22322903 2012 Genetic variations in the ADAMTS12 gene are associated with schizophrenia in Puerto Rican patients of Spanish descent.
22247065 2012 Negative effects of ADAMTS-7 and ADAMTS-12 on endplate cartilage differentiation.
21559743 2011 Expression of ADAMTS12 in colorectal cancer-associated stroma prevents cancer development and is a good prognostic indicator of colorectal cancer.
21494557 2011 Regulated expression of ADAMTS-12 in human trophoblastic cells: a role for ADAMTS-12 in epithelial cell invasion?
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
More...