Property Summary

NCBI Gene PubMed Count 23
Grant Count 32
R01 Count 17
Funding $3,298,015.09
PubMed Score 35.27
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.200 0.000
osteosarcoma 2.219 0.000
posterior fossa group B ependymoma 2.700 0.000
cystic fibrosis 2.436 0.000
Duchenne muscular dystrophy -1.036 0.002
limb girdle muscular dystrophy 2B -1.472 0.000
autosomal dominant Emery-Dreifuss muscul... -1.462 0.006
hereditary spastic paraplegia -1.232 0.020
acute quadriplegic myopathy -2.575 0.000
adrenocortical carcinoma 1.480 0.001
tuberculosis -1.200 0.007
lung cancer -1.400 0.005
diabetes mellitus -1.500 0.003
invasive ductal carcinoma -1.620 0.001
nasopharyngeal carcinoma -1.700 0.001
Breast cancer 1.300 0.000
ovarian cancer 1.600 0.004
chronic rhinosinusitis -1.876 0.041

Gene RIF (11)

PMID Text
23403313 Data indicte that acute myeloid leukemia (AML) with NPM1-MLF1 and AML with NPM1 mutations showed similar immunophenotypical and molecular features, including gene mutation patterns and gene expression profiling (GEP).
23271436 The subcellular localization of full-length human MLF1 is 14-3-3epsilon-independent.
22193965 changes in the subcellular localization of NPM, due to alterations in the relative abundance of NPM and NPM-MLF1 proteins, may contribute to the enhanced myeloid progenitor activity of Npm +/- cells
22151054 Data present the high-resolution crystal structure of this binding motif [MLF1(29-42)pSer34] in complex with 14-3-3epsilon and analyse the interaction with isothermal titration calorimetry.
20471513 MLF1 gene rearrangement is associated with acute myeloid leukemia.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17967869 shuttling of MLF1 is critical for the regulation of cell proliferation and a disturbance in the shuttling balance increases the cell's susceptibility to oncogenic transformation
17854834 Over-expression of MLF1 has little impact on skeletal muscle function in mice; progressive formation of protein aggregates in muscle are not necessarily pathogenic; MLF1 and MRJ may function together to ameliorate the toxic effects of mutant proteins.
14506644 These findings suggest that an NPM/MLF1 fusion is the primary molecular abnormality in t(3;5) MDS and AML with multilineage dysplasia, and that cases with NPM/MLF1 may be clinically distinct from other MDS-associated disease
12176995 phosphorylation of 14-3-3 binding site by MADM

AA Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS      1 - 70
SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET     71 - 140
RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR    141 - 210
HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK                211 - 268
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23403313 2013 Acute myeloid leukemia with translocation t(3;5): new molecular insights.
23271436 2013 Subcellular localization of full-length human myeloid leukemia factor 1 (MLF1) is independent of 14-3-3 proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22193965 2012 NPM-MLF1 synergizes with Npm haploinsufficiency to enhance myeloid progenitor activity.
22151054 2012 Structural insights of the MLF1/14-3-3 interaction.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20471513 2010 Detection of t(3;5) and NPM1/MLF1 rearrangement in an elderly patient with acute myeloid leukemia: clinical and laboratory study with review of the literature.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17967869 2008 Shuttling imbalance of MLF1 results in p53 instability and increases susceptibility to oncogenic transformation.
17854834 2008 Non-pathogenic protein aggregates in skeletal muscle in MLF1 transgenic mice.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15861129 2005 Myeloid leukemia factor 1 regulates p53 by suppressing COP1 via COP9 signalosome subunit 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15116101 2004 cDNA cloning and characterization of a novel gene encoding the MLF1-interacting protein MLF1IP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506644 2003 Detection of NPM/MLF1 fusion in t(3;5)-positive acute myeloid leukemia and myelodysplasia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176995 2002 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1.
8570204 1996 The t(3;5)(q25.1;q34) of myelodysplastic syndrome and acute myeloid leukemia produces a novel fusion gene, NPM-MLF1.