Property Summary

NCBI Gene PubMed Count 23
Grant Count 32
R01 Count 17
Funding $3,298,015.09
PubMed Score 35.27
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.200 0.000
osteosarcoma 2.219 0.000
posterior fossa group B ependymoma 2.700 0.000
cystic fibrosis 2.436 0.000
Duchenne muscular dystrophy -1.036 0.002
limb girdle muscular dystrophy 2B -1.472 0.000
autosomal dominant Emery-Dreifuss muscul... -1.462 0.006
hereditary spastic paraplegia -1.232 0.020
acute quadriplegic myopathy -2.575 0.000
adrenocortical carcinoma 1.480 0.001
tuberculosis -1.200 0.007
lung cancer -1.400 0.005
diabetes mellitus -1.500 0.003
invasive ductal carcinoma -1.620 0.001
nasopharyngeal carcinoma -1.700 0.001
Breast cancer 1.300 0.000
ovarian cancer 1.600 0.004
chronic rhinosinusitis -1.876 0.041

Gene RIF (11)

PMID Text
23403313 Data indicte that acute myeloid leukemia (AML) with NPM1-MLF1 and AML with NPM1 mutations showed similar immunophenotypical and molecular features, including gene mutation patterns and gene expression profiling (GEP).
23271436 The subcellular localization of full-length human MLF1 is 14-3-3epsilon-independent.
22193965 changes in the subcellular localization of NPM, due to alterations in the relative abundance of NPM and NPM-MLF1 proteins, may contribute to the enhanced myeloid progenitor activity of Npm +/- cells
22151054 Data present the high-resolution crystal structure of this binding motif [MLF1(29-42)pSer34] in complex with 14-3-3epsilon and analyse the interaction with isothermal titration calorimetry.
20471513 MLF1 gene rearrangement is associated with acute myeloid leukemia.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17967869 shuttling of MLF1 is critical for the regulation of cell proliferation and a disturbance in the shuttling balance increases the cell's susceptibility to oncogenic transformation
17854834 Over-expression of MLF1 has little impact on skeletal muscle function in mice; progressive formation of protein aggregates in muscle are not necessarily pathogenic; MLF1 and MRJ may function together to ameliorate the toxic effects of mutant proteins.
14506644 These findings suggest that an NPM/MLF1 fusion is the primary molecular abnormality in t(3;5) MDS and AML with multilineage dysplasia, and that cases with NPM/MLF1 may be clinically distinct from other MDS-associated disease
More...

AA Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS      1 - 70
SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET     71 - 140
RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR    141 - 210
HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK                211 - 268
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23403313 2013 Acute myeloid leukemia with translocation t(3;5): new molecular insights.
23271436 2013 Subcellular localization of full-length human myeloid leukemia factor 1 (MLF1) is independent of 14-3-3 proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22193965 2012 NPM-MLF1 synergizes with Npm haploinsufficiency to enhance myeloid progenitor activity.
22151054 2012 Structural insights of the MLF1/14-3-3 interaction.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20471513 2010 Detection of t(3;5) and NPM1/MLF1 rearrangement in an elderly patient with acute myeloid leukemia: clinical and laboratory study with review of the literature.
More...