Property Summary

NCBI Gene PubMed Count 28
PubMed Score 36.28
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy -2.502 3.1e-06
adrenocortical carcinoma 1.480 7.6e-04
autosomal dominant Emery-Dreifuss muscul... -1.462 6.1e-03
Breast cancer -1.100 2.3e-04
chronic rhinosinusitis -1.876 4.1e-02
cystic fibrosis 2.436 2.1e-05
diabetes mellitus -1.500 3.4e-03
Duchenne muscular dystrophy -1.036 1.6e-03
ependymoma 2.200 1.8e-11
hereditary spastic paraplegia -1.095 2.6e-02
invasive ductal carcinoma -1.240 5.6e-03
limb girdle muscular dystrophy 2B -1.472 4.0e-04
lung cancer -1.100 3.1e-02
malignant mesothelioma 1.100 3.5e-06
nasopharyngeal carcinoma -1.200 1.4e-02
osteosarcoma 2.154 5.7e-05
ovarian cancer 1.600 4.4e-03
psoriasis -1.200 4.6e-06
tuberculosis -1.200 6.6e-03

Gene RIF (15)

AA Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS      1 - 70
SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET     71 - 140
RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR    141 - 210
HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK                211 - 268
//

Text Mined References (30)

PMID Year Title