Property Summary

NCBI Gene PubMed Count 48
PubMed Score 336.96
PubTator Score 66.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 8.91292981923232E-34
posterior fossa group B ependymoma 1530 2.13692118978083E-16
ovarian cancer 8492 1.86980452503538E-13
astrocytoma 1493 4.85382221825194E-11
sonic hedgehog group medulloblastoma 1482 9.48806412966139E-11
juvenile dermatomyositis 1189 3.31904587407314E-9
acute quadriplegic myopathy 1157 8.1338671498475E-9
psoriasis 6685 4.59027781697195E-7
cystic fibrosis 1670 9.20729458799895E-7
pediatric high grade glioma 2712 2.01493806092498E-6
pilocytic astrocytoma 3086 5.48596914215184E-6
glioblastoma 5572 9.62629875364328E-6
breast carcinoma 1614 5.43000325213189E-5
tuberculosis and treatment for 6 months 686 5.53834022574626E-5
osteosarcoma 7933 7.9644567483375E-5
primary pancreatic ductal adenocarcinoma 1271 9.54955470279767E-5
atypical teratoid / rhabdoid tumor 4369 2.41163374430712E-4
medulloblastoma, large-cell 6234 3.09331504161214E-4
pancreatic cancer 2300 3.67068866797886E-4
primitive neuroectodermal tumor 3031 5.85634581489855E-4
ductal carcinoma in situ 1745 8.18263362321662E-4
invasive ductal carcinoma 2950 0.00116832043817536
adrenocortical carcinoma 1427 0.00442390805310086
fibroadenoma 557 0.00779594374405281
head and neck cancer 270 0.00799593220283903
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0109266421103576
non primary Sjogren syndrome sicca 840 0.0209039032951812
gastric carcinoma 832 0.0228722062634648
pituitary cancer 1972 0.0377886977220871
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 3.697 1.8
Cardiovascular system disease 194 0.0 1.0

Expression

Synonym

Accession P58335 Q4W5H6 Q59E98 Q5JPE9 Q86UI1 Q8N4J8 Q8NB13 Q96NC7
Symbols HFS
ISH
JHF
CMG2
CMG-2

Gene

PANTHER Protein Class (1)

PDB

1SHT   1SHU   1T6B   1TZN  

  Ortholog (12)

Gene RIF (32)

PMID Text
26805886 Roles of Anthrax Toxin Receptor 2 in Anthrax Toxin Membrane Insertion and Pore Formation
26703731 Anthrax Susceptibility: Human Genetic Polymorphisms Modulating ANTXR2 Expression
26107617 The disulfide bond Cys255-Cys279 in the immunoglobulin-like domain of ANTXR2 is required for membrane insertion of anthrax protective antigen pore.
25781883 CMG2 glycosylation provides a buffer towards genetic variation by promoting folding of the protein in the ER lumen.
25736362 miR-124 might induce autophagy to participate in AS by targeting ANTXR2, which might be implicated in pathological process of AS.
25169729 Ankylosing spondylitis is associated with the anthrax toxin receptor 2 gene.
24993339 Results show that CMG2 has been shown to be able to regulate the proliferation and tubule formation of endothelial cells, but not the migration.
24924630 data suggested that cellular cholesterol regulated ANTXR2-dependent activation of MMP-2 via ERK1/2 phosphorylation in neuroglioma U251 cell.
24742682 Silencing CMG2 using targeted siRNAs provided almost complete protection against anthrax lethal toxin-induced cytotoxicity and death in murine and human macrophages.
24667935 Loss of CMG2 expression is associated with breast cancer progression.
More...

AA Sequence

MVAERSPARSPGSWLFPGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLA      1 - 70
ERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTS     71 - 140
SIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGII    141 - 210
NSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCP    211 - 280
APILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIK    281 - 350
DPPPPPAPAPKEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPE    351 - 420
ETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEVCIWECIEKELTA     421 - 489
//

Text Mined References (50)

PMID Year Title
26805886 2016 Roles of Anthrax Toxin Receptor 2 in Anthrax Toxin Membrane Insertion and Pore Formation.
26703731 2015 Anthrax Susceptibility: Human Genetic Polymorphisms Modulating ANTXR2 Expression.
26107617 2015 The Disulfide Bond Cys255-Cys279 in the Immunoglobulin-Like Domain of Anthrax Toxin Receptor 2 Is Required for Membrane Insertion of Anthrax Protective Antigen Pore.
25781883 2015 Differential dependence on N-glycosylation of anthrax toxin receptors CMG2 and TEM8.
25736362 2015 MicroRNA-124 involves in ankylosing spondylitis by targeting ANTXR2.
25169729 2014 Ankylosing spondylitis is associated with the anthrax toxin receptor 2 gene (ANTXR2).
24993339 2014 Therapeutic potential of capillary morphogenesis gene 2 extracellular vWA domain in tumour?related angiogenesis.
24924630 2014 Cholesterol depletion induces ANTXR2-dependent activation of MMP-2 via ERK1/2 phosphorylation in neuroglioma U251 cell.
24742682 2014 Targeted silencing of anthrax toxin receptors protects against anthrax toxins.
24739539 2014 ANTXR2 is a potential causative gene in the genome-wide association study of the blood pressure locus 4q21.
More...