Property Summary

NCBI Gene PubMed Count 55
PubMed Score 346.45
PubTator Score 66.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Lytic lesion 32
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.178 8.1e-09
adrenocortical carcinoma -1.123 4.4e-03
adult high grade glioma 1.700 5.7e-05
astrocytoma 1.100 4.9e-11
Astrocytoma, Pilocytic 1.500 6.5e-06
atypical teratoid / rhabdoid tumor 1.400 3.0e-03
breast carcinoma -1.600 5.4e-05
cystic fibrosis 1.336 6.1e-05
ductal carcinoma in situ -1.600 8.2e-04
ependymoma 1.600 4.6e-02
fibroadenoma -1.800 7.8e-03
gastric carcinoma 1.400 2.3e-02
glioblastoma 1.600 1.9e-06
group 3 medulloblastoma 2.500 4.1e-06
head and neck cancer -1.200 8.0e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.8e-02
invasive ductal carcinoma -2.000 1.2e-03
juvenile dermatomyositis 1.046 3.3e-09
lung carcinoma -2.100 8.9e-34
medulloblastoma, large-cell 1.800 1.5e-03
non primary Sjogren syndrome sicca -1.200 2.1e-02
osteosarcoma 1.193 8.0e-05
ovarian cancer -3.500 1.9e-13
pancreatic cancer 1.300 9.9e-04
pancreatic ductal adenocarcinoma liver m... -1.589 3.6e-02
pituitary cancer -1.500 3.8e-02
primitive neuroectodermal tumor 1.700 2.9e-04
psoriasis -1.200 4.6e-07
tuberculosis -1.100 1.8e-06

Protein-protein Interaction (4)

Gene RIF (39)

AA Sequence

MVAERSPARSPGSWLFPGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLA      1 - 70
ERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTS     71 - 140
SIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGII    141 - 210
NSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCP    211 - 280
APILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIK    281 - 350
DPPPPPAPAPKEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPE    351 - 420
ETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEVCIWECIEKELTA     421 - 489
//

Text Mined References (57)

PMID Year Title