Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.5e-02
nasopharyngeal carcinoma 1.200 7.8e-06
ovarian cancer 1.300 3.2e-03
primitive neuroectodermal tumor 1.200 8.3e-04

Gene RIF (1)

AA Sequence

MAEIHNGGELCDFMENGEIFSEHSCLNAHMGTENTGDTYDCDEYGENFPMLHNSAPAGETLSVLNQCRKA      1 - 70
FSLPPNVHQRTWIGDKSFEYSDCEEAFVDQSHLQANRITHNGETLYEQKQCGRAFTYSTSHAVSVKMHTV     71 - 140
EKPYECKECGKFFRYSSYLNSHMRTHTGEKPYECKECGKCFTVSSHLVEHVRIHTGEKPYQCKECGRAFA    141 - 210
GRSGLTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKSFRSSSCLKNHFRIHTG    211 - 280
IKPYKCKECGKAFTVSSSLHNHVKIHTGEKPYECKDCGKAFATSSQLIEHIRTHTGEKPYICKECGKTFR    281 - 350
ASSHLQKHVRIHTGEKPYICNECGKAYNRFYLLTKHLKTH                                  351 - 390
//

Text Mined References (6)

PMID Year Title