Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAEIHNGGELCDFMENGEIFSEHSCLNAHMGTENTGDTYDCDEYGENFPMLHNSAPAGETLSVLNQCRKA      1 - 70
FSLPPNVHQRTWIGDKSFEYSDCEEAFVDQSHLQANRITHNGETLYEQKQCGRAFTYSTSHAVSVKMHTV     71 - 140
EKPYECKECGKFFRYSSYLNSHMRTHTGEKPYECKECGKCFTVSSHLVEHVRIHTGEKPYQCKECGRAFA    141 - 210
GRSGLTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKSFRSSSCLKNHFRIHTG    211 - 280
IKPYKCKECGKAFTVSSSLHNHVKIHTGEKPYECKDCGKAFATSSQLIEHIRTHTGEKPYICKECGKTFR    281 - 350
ASSHLQKHVRIHTGEKPYICNECGKAYNRFYLLTKHLKTH                                  351 - 390
//

Text Mined References (5)

PMID Year Title
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12934113 2003 Expression profiling and characterization of 4200 genes cloned from primary neuroblastomas: identification of 305 genes differentially expressed between favorable and unfavorable subsets.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8468057 1993 A novel zinc finger cDNA with a polymorphic pentanucleotide repeat (ATTTT)n maps on human chromosome 19p.