Property Summary

NCBI Gene PubMed Count 62
PubMed Score 80.42
PubTator Score 184.66

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
adrenocortical carcinoma 1427 0.00601913231520593
fibroadenoma 557 0.0451696407905819
Disease Target Count Z-score Confidence
pre-eclampsia 67 3.361 1.7


  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -1.029 0.006
fibroadenoma 1.200 0.045


Accession P58294 Q5VWD4 Q8TC69
Symbols PK1


PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (53)

26828479 Results show the biological effects of PROK1-V67I on cell functions are similar to those of wild type, and the common variant of V67I may act as a modifier in the PROK1-PROKR system through down-regulation of PROK1 expression.
26574895 Data suggest that prokineticins (PROK1 and PROK2) and prokineticin receptors (PROKR1 and PROKR2) act as main regulators of physiological functions of ovary, uterus, placenta, and testis. [REVIEW]
26475302 EG-VEGF and its receptor PKR1 might play a role in the pathogenesis of adrenocortical tumors and could serve as prognostic markers for this rare malignant disease.
26401590 PROK1 levels in follicular fluid and fertilization culture media could constitute new predictive noninvasive markers of successful embryo implantation in conventional in vitro fertilization-embryo transfer
26318037 The prognosis was poorer in colorectal cancers that expressed both PROK1 and VEGF relative to the cases that expressed only 1 protein, and the expression of both proteins was found to be an independent prognostic factor.
26192875 Expression of PROK1 and PROKR1 was significantly higher in mid-gestation ovaries (17-20 wk) than at earlier gestations (8-11 and 14-16 wk).
26047640 EG-VEGF, BV8, and PROKR2 gene expression is approximately five, four, and two times higher in cystic fibrosis lungs compared with controls.
25788276 Simultaneous targeting of both angiogenic growth factors (VEGF/PROK1) may prove more useful in colorectal cancer
25331005 High Prokineticin 1 protein expression is associated with sporadic colorectal cancer.
25128195 An increased mRNA expression of PROK1 and LIF could be one of the several abnormalities characterizing the endometrium in women recurrent pregnancy loss.

AA Sequence

RKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF                                        71 - 105

Text Mined References (64)

PMID Year Title
26828479 2016 A Common Variant of PROK1 (V67I) Acts as a Genetic Modifier in Early Human Pregnancy through Down-Regulation of Gene Expression.
26574895 2015 Prokineticins in central and peripheral control of human reproduction.
26475302 2015 Role of Endocrine Gland-Derived Vascular Endothelial Growth Factor (EG-VEGF) and Its Receptors in Adrenocortical Tumors.
26401590 2016 PROK1 Level in the Follicular Microenvironment: A New Noninvasive Predictive Biomarker of Embryo Implantation.
26318037 2015 The prognosis was poorer in colorectal cancers that expressed both VEGF and PROK1 (No correlation coefficient between VEGF and PROK1).
26192875 2015 Prokineticin Ligands and Receptors Are Expressed in the Human Fetal Ovary and Regulate Germ Cell Expression of COX2.
26047640 2015 EG-VEGF, BV8, and their receptor expression in human bronchi and their modification in cystic fibrosis: Impact of CFTR mutation (delF508).
25788276 2015 The anti-tumor effect is enhanced by simultaneously targeting VEGF and PROK1 in colorectal cancer.
25331005 2015 Prokineticin 1 protein expression is a useful new prognostic factor for human sporadic colorectal cancer.
25128195 2014 Prokineticin 1 and leukemia inhibitory factor mRNA expression in the endometrium of women with idiopathic recurrent pregnancy loss.