Property Summary

NCBI Gene PubMed Count 65
PubMed Score 85.41
PubTator Score 184.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adrenocortical carcinoma 1428 6.0e-03
fibroadenoma 559 4.5e-02
Disease Target Count Z-score Confidence
Pre-Eclampsia 68 3.708 1.9
Ovarian hyperstimulation syndrome 19 3.077 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -1.029 6.0e-03
fibroadenoma 1.200 4.5e-02

Gene RIF (56)

AA Sequence

MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFF      1 - 70
RKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF                                        71 - 105
//

Text Mined References (67)

PMID Year Title