Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
Funding $338,877.6
PubMed Score 14.46
PubTator Score 21.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma 1.300 0.000
glioblastoma 1.200 0.000
cystic fibrosis -1.301 0.000
primitive neuroectodermal tumor 1.100 0.001
tuberculosis 1.500 0.000
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.400 0.000

Gene RIF (9)

PMID Text
26957899 Our results suggest that null mutations in LOXL3 are likely associated with autosomal recessive early-onset high myopia. LOXL3 is a potential candidate gene for high myopia, but this possibility should be confirmed in additional studies.
25663169 LOXL3 is a novel candidate gene for autosomal recessive Stickler syndrome.
23357697 TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4).
21740577 The human lysyl oxidase-like 3 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis.
19724858 Expression of LOXL, LOXL2, LOXL3 and LOXL4 was not statistically associated with tumor location, stage, growth type, or differentiation status in colorectal adenocarcinomas
19015874 Breast carcinoma effusions showed significantly higher LOXL2 and lower LOXL3 expression compared to primary carcinomas.
17287949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17018530 LOXL3 encodes two variants, LOXL3 and LOXL3-sv1, both of which function as amine oxidases with distinct tissue and substrate specificities from one another.
16096638 Lysyl-oxidase-like 3 interacts and cooperates with Snail to downregulate E-cadherin expression, and control epithelial-mesenchymal transitions and carcinoma progression.

AA Sequence

MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTGPEKKAGSQGLRFRLAGFPRKPYEGRVEIQRAGEWGTIC      1 - 70
DDDFTLQAAHILCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDA     71 - 140
GVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNS    141 - 210
HVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGGPAVVS    211 - 280
CVPGPVYAASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGF    281 - 350
GSAREALSGARMGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS    351 - 420
GGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSGNITEVVMSGV    421 - 490
RCTGTELSLDQCAHHGTHITCKRTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENC    491 - 560
LASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVA    561 - 630
EGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFE    631 - 700
VAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII                     701 - 753
//

Text Mined References (17)

PMID Year Title
26957899 2016 Exome sequencing identified null mutations in LOXL3 associated with early-onset high myopia.
25663169 2015 LOXL3, encoding lysyl oxidase-like 3, is mutated in a family with autosomal recessive Stickler syndrome.
23357697 2013 TGF-beta1 induces the different expressions of lysyl oxidases and matrix metalloproteinases in anterior cruciate ligament and medial collateral ligament fibroblasts after mechanical injury.
21740577 2011 Common polymorphisms in human lysyl oxidase genes are not associated with the adolescent idiopathic scoliosis phenotype.
19724858 2009 Differential expression of the LOX family genes in human colorectal adenocarcinomas.
19015874 2009 Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.
17287949 2007 Systematic screening of lysyl oxidase-like (LOXL) family genes demonstrates that LOXL2 is a susceptibility gene to intracranial aneurysms.
17018530 2006 A tissue-specific variant of the human lysyl oxidase-like protein 3 (LOXL3) functions as an amine oxidase with substrate specificity.
16096638 2005 A molecular role for lysyl oxidase-like 2 enzyme in snail regulation and tumor progression.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...