Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.78
PubTator Score 21.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Stickler syndrome 13 3.966 2.0
Disease Target Count Z-score Confidence
Irregular astigmatism 12 3.773 1.9
Cleft Palate 271 3.042 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 2.1e-09
cystic fibrosis -1.301 1.2e-05
ependymoma 1.200 4.0e-02
glioblastoma 1.200 1.6e-08
pediatric high grade glioma 1.100 7.4e-06
primitive neuroectodermal tumor 1.100 9.5e-04
tuberculosis 1.500 1.3e-06

Protein-protein Interaction (10)

Gene RIF (10)

AA Sequence

MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTGPEKKAGSQGLRFRLAGFPRKPYEGRVEIQRAGEWGTIC      1 - 70
DDDFTLQAAHILCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDA     71 - 140
GVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNS    141 - 210
HVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGGPAVVS    211 - 280
CVPGPVYAASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGF    281 - 350
GSAREALSGARMGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS    351 - 420
GGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSGNITEVVMSGV    421 - 490
RCTGTELSLDQCAHHGTHITCKRTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENC    491 - 560
LASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVA    561 - 630
EGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFE    631 - 700
VAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII                     701 - 753
//

Text Mined References (19)

PMID Year Title