Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.65
PubTator Score 0.75

Knowledge Summary

Patent (268)

Gene RIF (2)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
19833159 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFFLGNLSYLDIC      1 - 70
YSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDLSVAICKPLRYTVIMNPQLCT     71 - 140
QMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIKPLLKLACGNTELNQWLLSTVTGTIAMGPFF    141 - 210
LTLLSYFYIITYLFFKTRSCSMLCKALSTCASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVV    211 - 280
TPVLNPLIYTLRNKEVKGALGRVIRRL                                               281 - 307
//

Text Mined References (11)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19833159 2010 Sequence variations at the human leukocyte antigen-linked olfactory receptor cluster do not influence female preferences for male odors.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...