Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.05
PubTator Score 1.05

Knowledge Summary

Patent (210)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Atopic dermatitis 944 3.115 1.6

AA Sequence

MKRQNQSCVVEFILLGFSNFPELQVQLFGVFLVIYVVTLMGNAIITVIISLNQSLHVPMYLFLLNLSVVE      1 - 70
VSFSAVITPEMLVVLSTEKTMISFVGCFAQMYFILLFGGTECFLLGAMAYDRFAAICHPLNYPVIMNRGV     71 - 140
FMKLVIFSWISGIMVATVQTTWVFSFPFCGPNEINHLFCETPPVLELVCADTFLFEIYAFTGTILIVMVP    141 - 210
FLLILLSYIRVLFAILKMPSTTGRQKAFSTCASHLTSVTLFYGTANMTYLQPKSGYSPETKKLISLAYTL    211 - 280
LTPLLNPLIYSLRNSEMKRTLIKLWRRKVILHTF                                        281 - 314
//

Text Mined References (7)

PMID Year Title
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.