Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent (377)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 8.9e-11
osteosarcoma 7950 9.1e-07
medulloblastoma, large-cell 6241 3.2e-05
adult high grade glioma 3801 3.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMYFLLRNLAVLD      1 - 70
LCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAFDRLIAISRPLRYVTVMNTQL     71 - 140
WVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLKISNSGLLDVVW    141 - 210
FFLLLMSYLFILVMLRSHPGEARRKAASTCTTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTP    211 - 280
MLNPMIYTLRNQDMQAAVRRLGRHRLV                                               281 - 307
//

Text Mined References (3)

PMID Year Title