Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent (377)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 8.877929150914E-11
osteosarcoma 7933 9.11818499237303E-7
medulloblastoma, large-cell 6234 3.15475960238142E-5
adult high grade glioma 2148 0.00299491812931293

Synonym

Accession P58180 Q6IFN8 Q96R75
Symbols BC2009
OR17-24

Gene

  Ortholog (5)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMYFLLRNLAVLD      1 - 70
LCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAFDRLIAISRPLRYVTVMNTQL     71 - 140
WVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLKISNSGLLDVVW    141 - 210
FFLLLMSYLFILVMLRSHPGEARRKAASTCTTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTP    211 - 280
MLNPMIYTLRNQDMQAAVRRLGRHRLV                                               281 - 307
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.