Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40
PubTator Score 3.00

Knowledge Summary

Patent (422)

AA Sequence

MDGDNQSENSQFLLLGISESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMYFFLANLSFTD      1 - 70
LFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAYDRYVATCCPLHYVTAMSPGL     71 - 140
CVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCDMYILLWLACSNTHIIHTALIATGCFIFLTP    141 - 210
LGFMTTSYVRIVRTILQMPSASKKYKTFSTCASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVL    211 - 280
TPMMNPFIYRLRNKDMHGAPGRVLWRPFQRPK                                          281 - 312
//

Text Mined References (5)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
1315913 1992 Novel G protein-coupled receptors: a gene family of putative human olfactory receptor sequences.