Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40
PubTator Score 3.00

Knowledge Summary

Patent (422)

AA Sequence

MDGDNQSENSQFLLLGISESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMYFFLANLSFTD      1 - 70
LFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAYDRYVATCCPLHYVTAMSPGL     71 - 140
CVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCDMYILLWLACSNTHIIHTALIATGCFIFLTP    141 - 210
LGFMTTSYVRIVRTILQMPSASKKYKTFSTCASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVL    211 - 280
TPMMNPFIYRLRNKDMHGAPGRVLWRPFQRPK                                          281 - 312
//

Text Mined References (5)

PMID Year Title