Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.79
PubTator Score 447.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -2.095 2.8e-03
juvenile dermatomyositis 1.254 4.5e-05
lung cancer 1.100 2.1e-02
malignant mesothelioma 5.400 5.2e-10
medulloblastoma, large-cell 1.300 4.2e-02
pancreatic ductal adenocarcinoma liver m... -2.141 2.1e-02
Polycystic ovary syndrome -1.226 4.1e-02

 MGI Phenotype (1)

 CSPA Cell Line (2)

Protein-protein Interaction (7)

Gene RIF (9)

AA Sequence

MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQA      1 - 70
ALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCL     71 - 140
RIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLD    141 - 210
TAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQC    211 - 280
PPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS    281 - 350
//

Text Mined References (18)

PMID Year Title