Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.78
PubTator Score 447.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 5.400 0.000
cystic fibrosis -2.095 0.003
medulloblastoma, large-cell 1.300 0.042
juvenile dermatomyositis 1.254 0.000
pancreatic ductal adenocarcinoma liver m... -2.141 0.021
lung cancer 1.100 0.021
Polycystic Ovary Syndrome -1.226 0.041

Synonym

Accession P58166
Symbols

Gene

PANTHER Protein Class (2)

 MGI Term (1)

Gene RIF (9)

PMID Text
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
23580013 The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line.
21092084 differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20033758 An immunolabelling of the inhibin-betaE subunit in normal and malignant cervical tissue, as well as cervical cancer cells, is demonstrated.
20012305 Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line.
18413775 Observational study of gene-disease association. (HuGE Navigator)
16426570 activin E has a role in regulating the proliferation of pancreatic exocrine cells
12242034 cDNA cloning from a liver cDNA library, deduction of amino acid sequence, binding to follistatin, and analysis of the transcript in human liver

AA Sequence

MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQA      1 - 70
ALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCL     71 - 140
RIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLD    141 - 210
TAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQC    211 - 280
PPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS    281 - 350
//

Text Mined References (18)

PMID Year Title
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580013 2013 The inhibin-?C subunit is down-regulated, while inhibin-?E is up-regulated by interferon-?1a in Ishikawa carcinoma cell line.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21092084 2010 Evidence of inhibin/activin subunit betaC and betaE synthesis in normal human endometrial tissue.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20033758 2009 Inhibin/activin-betaE subunit in normal and malignant human cervical tissue and cervical cancer cell lines.
20012305 2010 Inhibin/activin-betaC and -betaE subunits in the Ishikawa human endometrial adenocarcinoma cell line.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18413775 2008 Genetic variation in the inhibin pathway and risk of testicular germ cell tumors.
More...