Property Summary

NCBI Gene PubMed Count 20
PubMed Score 43.88
PubTator Score 50.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 540 2.8e-03
nasopharyngeal carcinoma 1058 8.7e-03
Disease Target Count Z-score Confidence
esophageal cancer 22 4.733 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple Sclerosis 2.000 2.8e-03
nasopharyngeal carcinoma -1.400 8.7e-03

Gene RIF (20)

AA Sequence

MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTES      1 - 70
LKSNGRVQFLHDGSC                                                            71 - 85
//

Text Mined References (20)

PMID Year Title