Property Summary

NCBI Gene PubMed Count 18
PubMed Score 40.97
PubTator Score 50.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple Sclerosis 2.000 0.003
nasopharyngeal carcinoma -1.400 0.009

Gene RIF (18)

PMID Text
22528291 Conformational study of ECRG2 using NMR.
22315007 miR-1322 can regulate ECRG2 in an allele-specific manner and that serum levels of miR-1322 can serve as a potential diagnostic biomarker for patients with ESCC.
21042721 ECRG2 is a novel member of the Kazal-type serine protease inhibitor family and may function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer.
19796867 ECRG2 regulates invasion/migration partly through ECM degradation and uPA/uPAR/FPRL1 pathway
19717562 ECRG2 is involved in the regulation of cell migration/invasion through uPA/uPAR/beta1 integrin pathway.
18824154 uPA-binding loops of ECRG2 are in correspondence with the reactive site loops for binding of serine proteinase in turkey ovomucoid third domain (OMTKY3).
18618216 the ECRG2 TCA (3)/TCA (4) genotype is associated with the risk of oesophageal carcinoma in a North Indian population.
18618216 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18162463 ECRG2 is important for ensuring centrosome duplication, spindle assembly checkpoint, and accurate chromosome segregation, and its depletion may contribute to chromosome instability and aneuploidy in human cancers.
17693286 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTES      1 - 70
LKSNGRVQFLHDGSC                                                            71 - 85
//

Text Mined References (18)

PMID Year Title
22528291 2012 NMR structure note: human esophageal cancer-related gene 2.
22315007 2013 MicroRNA-1322 regulates ECRG2 allele specifically and acts as a potential biomarker in patients with esophageal squamous cell carcinoma.
21042721 2010 Molecular cloning and characterization of a novel esophageal cancer related gene.
19796867 2010 ECRG2 regulates ECM degradation and uPAR/FPRL1 pathway contributing cell invasion/migration.
19717562 2009 ECRG2 regulates cell migration/invasion through urokinase-type plasmin activator receptor (uPAR)/beta1 integrin pathway.
18824154 2008 Mapping the putative binding site for uPA protein in Esophageal Cancer-Related Gene 2 by heteronuclear NMR method.
18618216 2008 Association of ECRG2 TCA short tandem repeat polymorphism with the risk of oesophageal cancer in a North Indian population.
18162463 2008 ECRG2 disruption leads to centrosome amplification and spindle checkpoint defects contributing chromosome instability.
17693286 2007 Short tandem repeat polymorphism in exon 4 of esophageal cancer-related gene 2 detected in genomic DNA is a prognostic marker for esophageal cancer.
17602171 2007 ECRG2 inhibits cancer cell migration, invasion and metastasis through the down-regulation of uPA/plasmin activity.
More...