Property Summary

NCBI Gene PubMed Count 154
PubMed Score 652.11
PubTator Score 456.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 1.1e-05
pituitary cancer 1972 8.2e-03
sonic hedgehog group medulloblastoma 467 1.2e-02
Disease Target Count Z-score Confidence
blepharophimosis, ptosis, and epicanthus inversus syndrome 8 8.372 4.0
Disease Target Count Z-score Confidence
Premature ovarian failure 65 6.673 3.3

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer -1.500 1.1e-05
pituitary cancer -2.000 8.2e-03
sonic hedgehog group medulloblastoma 1.300 1.2e-02

Gene RIF (148)

AA Sequence

MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRES      1 - 70
AEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEK     71 - 140
GNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSWPLPQPP    141 - 210
SPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGGP    211 - 280
PAAPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQ    281 - 350
PELAMMHCSYWDHDSKTGALHSRLDL                                                351 - 376
//

Text Mined References (157)

PMID Year Title