Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.14
PubTator Score 10.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25615886 SESN3 positively regulates the gene network module in macrophages, microglia and neurons.
24833709 Suggest that inhibitory effect of ethanol on Sesn3 may play an important role in the development of ethanol-induced fatty liver.
24260131 findings suggest the existence of a novel mechanism for the generation of antileukemic responses in CML cells, involving upregulation of SESN3 expression.
24129397 Sestrin 3 is upregulated in T2D and could influence skeletal muscle differentiation without altering glucose and lipid metabolism.
23388456 HSF1/SESN3/reactive oxygen species/p21(Cip1/WAF1)-mediated deceleration of cell growth may contribute to cell defense systems protecting the organism from excessive proliferation of cells that overexpress activated Ras oncoproteins.
20412774 FoxOs inhibit mTORC1 and activate Akt by inducing the expression of Sestrin3 and Rictor
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTSG      1 - 70
RLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAE     71 - 140
WLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGS    141 - 210
GINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEE    211 - 280
ASQEEMSTRFEKEKKESLFVVSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFR    281 - 350
AQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDY    351 - 420
DYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRH    421 - 490
LT                                                                        491 - 492
//

Text Mined References (19)

PMID Year Title
26449471 2016 Sestrin2 is a leucine sensor for the mTORC1 pathway.
25615886 2015 Systems genetics identifies Sestrin 3 as a regulator of a proconvulsant gene network in human epileptic hippocampus.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24833709 2014 The inhibitory effect of ethanol on Sestrin3 in the pathogenesis of ethanol-induced liver injury.
24260131 2013 Regulatory effects of sestrin 3 (SESN3) in BCR-ABL expressing cells.
24129397 2013 Sestrin 3 regulation in type 2 diabetic patients and its influence on metabolism and differentiation in skeletal muscle.
23388456 2013 Ras-induced ROS upregulation affecting cell proliferation is connected with cell type-specific alterations of HSF1/SESN3/p21Cip1/WAF1 pathways.
22958918 2012 Maintenance of metabolic homeostasis by Sestrin2 and Sestrin3.
22349704 2012 FOXO3-induced reactive oxygen species are regulated by BCL2L11 (Bim) and SESN3.
More...