Property Summary

NCBI Gene PubMed Count 52
PubMed Score 92.58
PubTator Score 39.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Hepatomegaly 285 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 4.2e-05
medulloblastoma, large-cell 6241 6.1e-05
tuberculosis 2010 8.1e-05
Pick disease 1894 4.2e-04
group 3 medulloblastoma 4104 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.036 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.300 1.3e-03
medulloblastoma, large-cell -1.100 6.1e-05
osteosarcoma 2.223 4.2e-05
Pick disease 1.100 4.2e-04
tuberculosis -1.100 8.1e-05

Synonym

Accession P58004 Q5T7D0 Q96SI5
Symbols HI95
SES2
SEST2

Gene

PANTHER Protein Class (2)

PDB

5CUF   5DJ4   5T0N  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (39)

AA Sequence

MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEAL      1 - 70
MSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTG     71 - 140
GDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSF    141 - 210
VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQ    211 - 280
EEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS    281 - 350
LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN    351 - 420
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT              421 - 480
//

Text Mined References (58)

PMID Year Title