Property Summary

NCBI Gene PubMed Count 44
Grant Count 22
R01 Count 14
Funding $2,170,516.61
PubMed Score 73.00
PubTator Score 39.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.223 0.000
medulloblastoma, large-cell -1.100 0.000
tuberculosis and treatment for 3 months -1.400 0.000
group 3 medulloblastoma -1.300 0.001
Pick disease 1.100 0.000

Gene RIF (31)

PMID Text
26771712 The up-regulation of SESN2 by mitochondrial dysfunction requires binding to ATF4.
26612684 Sesn2 has two subdomains. The N-terminal domain reduces alkylhydroperoxide radicals through its helix-turn-helix oxidoreductase motif, and the C-terminal domain interacts with GATOR2 and subsequently inhibits mTORC1.
26586190 this study presents the 2.7 angstrom crystal structure of Sestrin2 in complex with leucine.
26449471 These results indicate that Sestrin2 is a leucine sensor for the mTORC1 pathway.
26313705 Sestrin2 silencing strongly inhibits cytokine-induced cell death.
26133704 Sestrin2: A Promising Therapeutic Target for Liver Diseases
25962159 Sesn2 is a potential tumor suppressor in lung epithelial cells. The expression level of Sesn2 may serve as a prognostic marker for Chinese lung cancer patients in the clinic.
25819761 Sestrin2 inhibits mTORC1 through modulation of GATOR complexes
25802279 GAA promotes FoxO3 nuclear translocation and binding to the SESN2 enhancer.
25778901 SESN2-AMPK signaling could exert a protective effect against glucose deprivation-induced cell death and that this effect is mediated by restoration of mitochondrial function.
More...

AA Sequence

MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEAL      1 - 70
MSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTG     71 - 140
GDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSF    141 - 210
VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQ    211 - 280
EEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS    281 - 350
LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN    351 - 420
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT              421 - 480
//

Text Mined References (50)

PMID Year Title
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
26771712 2016 Mitochondrial dysfunction induces SESN2 gene expression through Activating Transcription Factor 4.
26612684 2015 Janus-faced Sestrin2 controls ROS and mTOR signalling through two separate functional domains.
26586190 2016 Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway.
26449471 2016 Sestrin2 is a leucine sensor for the mTORC1 pathway.
26313705 2015 Sestrin2 facilitates death receptor-induced apoptosis in lung adenocarcinoma cells through regulation of XIAP degradation.
26133704 2015 Sestrin2: A Promising Therapeutic Target for Liver Diseases.
25962159 2015 An ShRNA Based Genetic Screen Identified Sesn2 as a Potential Tumor Suppressor in Lung Cancer via Suppression of Akt-mTOR-p70S6K Signaling.
25819761 2015 Sestrin2 inhibits mTORC1 through modulation of GATOR complexes.
25802279 2015 Gossypol Acetic Acid Prevents Oxidative Stress-Induced Retinal Pigment Epithelial Necrosis by Regulating the FoxO3/Sestrin2 Pathway.
More...