Property Summary

NCBI Gene PubMed Count 21
Grant Count 21
R01 Count 11
Funding $1,967,920.11
PubMed Score 47.01
PubTator Score 28.92

Knowledge Summary

Patent (2,296)

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group A ependymoma -1.400 0.000
psoriasis 3.800 0.000
group 3 medulloblastoma -1.700 0.002
astrocytoma -1.100 0.012
medulloblastoma, large-cell -2.000 0.000
colon cancer -1.400 0.004
active ulcerative colitis -1.196 0.021
adult high grade glioma -1.100 0.006
subependymal giant cell astrocytoma -1.776 0.035
lung carcinoma 2.500 0.000
ovarian cancer -1.400 0.000

Gene RIF (11)

PMID Text
26381449 This study showed that KCNK10 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders.
26332952 How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2.
26271386 The selectivity filter conformations of alternative translation initiation isoforms and wild type human TREK-2 are similar in the S4 site and pHo position.
25982558 Results suggest that the cytosolic C-terminal domain and the bottom of transmembrane segment M2 are required for the 2-aminoethoxydiphenyl borate activation on TREK-2 channels
25766236 crystal structures of TREK-2 channel in 2 conformations and in complex with norfluoxetine, a state-dependent blocker of TREK channels; results provide an explanation for TREK channel mechanosensitivity, regulation by diverse stimuli and possible off-target effects of Prozac
25197053 PLD2, but not PLD1, directly binds to the C terminus of TREK1 and TREK2.
25168769 Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation
23479219 High TREK-2 expression is associated with epithelial ovarian cancer.
21669980 Tissue-specific mRNA splicing regulates alternative translation initiation (ATI) of human K(2P)10.1 K+ background channels via recombination of 5 nucleotide motifs.
17689202 Predicts the role of TREK-2 in brain ischemia, memory and other tissues.[REVIEW]
More...

AA Sequence

MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQGGLQTVMKWK      1 - 70
TVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETLIQHALDADNAGVS     71 - 140
PIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF    141 - 210
GKSIARVEKVFRKKQVSQTKIRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFG    211 - 280
DFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAE    281 - 350
FRETRRRLSVEIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP    351 - 420
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEET    421 - 490
EKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN                          491 - 538
//

Text Mined References (24)

PMID Year Title
27241700 2016 Polymodal activation of the TREK-2 K2P channel produces structurally distinct open states.
26381449 2015 The association of DNA methylation and brain volume in healthy individuals and schizophrenia patients.
26332952 2015 How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2.
26271386 2015 The isoforms generated by alternative translation initiation adopt similar conformation in the selectivity filter in TREK-2.
25982558 2015 Insights into the stimulatory mechanism of 2-aminoethoxydiphenyl borate on TREK-2 potassium channel.
25766236 2015 K2P channel gating mechanisms revealed by structures of TREK-2 and a complex with Prozac.
25197053 2014 Phospholipase D2 specifically regulates TREK potassium channels via direct interaction and local production of phosphatidic acid.
25168769 2014 Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation.
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
23479219 2013 Expression and effects of modulation of the K2P potassium channels TREK-1 (KCNK2) and TREK-2 (KCNK10) in the normal human ovary and epithelial ovarian cancer.
More...