Property Summary

Ligand Count 6
NCBI Gene PubMed Count 22
PubMed Score 55.08
PubTator Score 28.92

Knowledge Summary

Patent (2,296)

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis -1.196 2.1e-02
adult high grade glioma -1.100 6.1e-03
astrocytoma -1.100 1.2e-02
colon cancer -1.400 4.1e-03
ependymoma -1.300 2.3e-02
group 3 medulloblastoma -1.400 2.5e-02
lung carcinoma 2.500 2.6e-15
medulloblastoma, large-cell -1.500 1.4e-02
ovarian cancer -1.400 2.1e-05
psoriasis 1.600 5.0e-04
subependymal giant cell astrocytoma -1.446 1.1e-03

Gene RIF (12)

AA Sequence

MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQGGLQTVMKWK      1 - 70
TVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETLIQHALDADNAGVS     71 - 140
PIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF    141 - 210
GKSIARVEKVFRKKQVSQTKIRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFG    211 - 280
DFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAE    281 - 350
FRETRRRLSVEIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP    351 - 420
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEET    421 - 490
EKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN                          491 - 538
//

Text Mined References (25)

PMID Year Title