Property Summary

NCBI Gene PubMed Count 17
Grant Count 169
R01 Count 59
Funding $40,727,115.54
PubMed Score 24.94
PubTator Score 21.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.059 0.002
medulloblastoma, large-cell -1.100 0.001
adult high grade glioma -1.100 0.000

Synonym

Accession P57775 Q5SVS1 Q96IM6
Symbols DAC
FBW4
FBWD4
SHFM3
SHSF3

Gene

Gene RIF (4)

PMID Text
23658844 biochemical characterization of the novel F-box and WD40 containing protein, FBXW4
16761290 Genomic rearrangements involving the SHFM3 locus at chromosome 10q24 is associated with syndromic and non-syndromic split-hand/foot malformation
16235095 results indicate that genomic rearrangement of SHFM3 is rare among non-syndromic SHFM patients and emphasize the importance of screening for genomic rearrangements even in sporadic cases of SHFM
12913067 a complex rearrangement associated with a approximately 0.5 Mb tandem duplication ion containing a disrupted extra copy of the DACTYLIN gene and the entire LBX1 and beta-TRCP genes.

AA Sequence

MAAAAGEEEEEEEAARESAARPAAGPALWRLPEELLLLICSYLDMRALGRLAQVCRWLRRFTSCDLLWRR      1 - 70
IARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQMPWMQLEDDSLYISQANFIL     71 - 140
AYQFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAGGDGKIGIHKIHSTFTVKYSAHEQEVNCVDC    141 - 210
KGGIIVSGSRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSG    211 - 280
QLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHL    281 - 350
LATGSSYYGVVRLWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFQNP            351 - 412
//

Text Mined References (17)

PMID Year Title
23658844 2013 The novel ubiquitin ligase complex, SCF(Fbxw4), interacts with the COP9 signalosome in an F-box dependent manner, is mutated, lost and under-expressed in human cancers.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
16761290 2006 Frequency of genomic rearrangements involving the SHFM3 locus at chromosome 10q24 in syndromic and non-syndromic split-hand/foot malformation.
16235095 2005 Genomic rearrangement at 10q24 in non-syndromic split-hand/split-foot malformation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232212 2004 Molecular genetic characterization of a Korean split hand/split foot malformation (SHFM).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699611 2004 The 10q24-linked split hand/split foot syndrome (SHFM3): narrowing of the critical region and confirmation of the clinical phenotype.
14603323 2003 Degradation of Cdc25A by beta-TrCP during S phase and in response to DNA damage.
More...