Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.64
PubTator Score 4.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.200 0.045
cystic fibrosis 1.177 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
medulloblastoma, large-cell -1.500 0.001
ovarian cancer -1.100 0.000

Synonym

Accession P57768 A8K4D8 Q658L0 Q8N4U3
Symbols

Gene

Gene RIF (2)

PMID Text
19754948 Observational study of gene-disease association. (HuGE Navigator)
12813048 SNX16 is a sorting nexin that may function in the trafficking of proteins between the early and late endosomal compartments

AA Sequence

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS      1 - 70
PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV     71 - 140
VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF    141 - 210
LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE    211 - 280
ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED          281 - 344
//

Text Mined References (21)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
19754948 2009 Evaluation of nine candidate genes in patients with normal tension glaucoma: a case control study.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...