Property Summary

NCBI Gene PubMed Count 42
PubMed Score 31.49
PubTator Score 29.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.2e-07
colon cancer 1.800 4.4e-02
dermatomyositis 1.300 1.8e-04
ependymoma 1.200 2.1e-07
glioblastoma 1.500 3.8e-07
group 3 medulloblastoma 2.500 4.1e-06
lung cancer 2.300 1.1e-03
malignant mesothelioma 1.200 6.8e-07
medulloblastoma, large-cell 1.500 1.8e-04
nasopharyngeal carcinoma 1.200 1.9e-04
oligodendroglioma 1.100 8.5e-12
ovarian cancer -1.200 1.7e-04
pediatric high grade glioma 1.400 2.5e-05
primitive neuroectodermal tumor 1.600 1.8e-05
progressive supranuclear palsy -1.200 1.0e-02
Waldenstrons macroglobulinemia 1.296 1.5e-02

Gene RIF (21)

AA Sequence

MDRSGFGEISSPVIREAEVTRTARKQSAQKRVLLQASQDENFGNTTPRNQVIPRTPSSFRQPFTPTSRSL      1 - 70
LRQPDISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSGLFTNTEPHSITEDVTISAVM     71 - 140
LREDDPGEAASMSMFSDFLQSFLKHSSSTVFDLVEEYENICGSQVNILSKIVSRATPGLQKFSKTASMLW    141 - 210
LLQQEMVTWRLLASLYRDRIQSALEEESVFAVTAVNASEKTVVEALFQRDSLVRQSQLVVDWLESIAKDE    211 - 280
IGEFSDNIEFYAKSVYWENTLHTLKQRQLTSYVGSVRPLVTELDPDAPIRQKMPLDDLDREDEVRLLKYL    281 - 350
FTLIRAGMTEEAQRLCKRCGQAWRAATLEGWKLYHDPNVNGGTELEPVEGNPYRRIWKISCWRMAEDELF    351 - 420
NRYERAIYAALSGNLKQLLPVCDTWEDTVWAYFRVMVDSLVEQEIQTSVATLDETEELPREYLGANWTLE    421 - 490
KVFEELQATDKKRVLEENQEHYHIVQKFLILGDIDGLMDEFSKWLSKSRNNLPGHLLRFMTHLILFFRTL    491 - 560
GLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEADL    561 - 630
DVATITKTVVENIRKKDNGEFSHHDLAPALDTGTTEEDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFL    631 - 700
ASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSV    701 - 770
PQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDH    771 - 840
ERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKLLQKLRESSLM    841 - 910
LLDQGLDPLGYEIQL                                                           911 - 925
//

Text Mined References (52)

PMID Year Title