Property Summary

NCBI Gene PubMed Count 91
PubMed Score 269.19
PubTator Score 114.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Pancreatitis 123 3.329 1.7
Disease Target Count P-value
active ulcerative colitis 764 1.0e-03
pancreatic cancer 2398 2.4e-03
active Crohn's disease 922 2.6e-03
interstitial lung disease 298 4.0e-02
Disease Target Count Z-score Confidence
Inflammatory bowel disease 151 4.884 2.4
Diarrhea 253 3.221 1.6
Cancer 2499 3.119 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease 3.201 2.6e-03
active ulcerative colitis 4.392 1.0e-03
interstitial lung disease 1.800 4.0e-02
pancreatic cancer 1.300 2.4e-03

Gene RIF (72)

AA Sequence

MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL      1 - 70
LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL     71 - 140
HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR    141 - 210
PGQPPKVKSEFNSYSLTGYV                                                      211 - 230
//

Text Mined References (92)

PMID Year Title