Property Summary

NCBI Gene PubMed Count 80
Grant Count 46
R01 Count 32
Funding $4,841,098.87
PubMed Score 237.42
PubTator Score 114.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial lung disease 1.800 0.040
active Crohn's disease 3.201 0.003
active ulcerative colitis 4.392 0.001
pancreatic cancer 1.300 0.002

Gene RIF (61)

PMID Text
26820620 Genetic variants in CLDN2 and MORC4 genes were associated with chronic pancreatitis in Indian patients.
26568313 The authors conclude that claudin-2 forms gated paracellular channels.
26212084 The current study reveals an important and novel mechanism for VDR by regulation of epithelial barriers.
26110235 Association of claudin2 (rs7057398) polymorphism with idiopathic recurrent acute pancreatitis and progression of the disease to chronic pancreatitis.
26061016 Quercetin decreases claudin-2 expression mediated by up-regulation of miR-16 expression and instability of claudin-2 mRNA in lung adenocarcinoma cells.
26023235 Phosphorylation state of the tyrosine of claudin-1 and claudin-2 regulates interaction with ZO1.
25948735 TNF--alpha modifies claudin-2 expression in tubular cells and this can have both short-term and long-term effects on transport and barrier functions.
25823815 Pan-inhibition of SFK signaling pathways elevated Claudin-2 expression levels in breast cancer cells. Loss of Yes or Fyn induces Claudin-2 expression; whereas, diminished Lyn levels impairs Claudin-2 expression in breast cancer cells.
25694446 PKCiota binds to Rab14 and that PKCiota requires Rab14 for its correct distribution in cells. As with Rab14, PKCiota protects claudin-2 from lysosomal degradation and, in consequence, modulates epithelial barrier.
25616664 Autophagy reduces the paracellular permeability of small solutes and ions via degradation of the pore-forming tight junction protein claudin-2.
More...

AA Sequence

MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL      1 - 70
LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL     71 - 140
HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR    141 - 210
PGQPPKVKSEFNSYSLTGYV                                                      211 - 230
//

Text Mined References (81)

PMID Year Title
26820620 2016 Common Variants in CLDN2 and MORC4 Genes Confer Disease Susceptibility in Patients with Chronic Pancreatitis.
26568313 2015 Claudin-2-dependent paracellular channels are dynamically gated.
26212084 2015 Tight junction CLDN2 gene is a direct target of the vitamin D receptor.
26110235 2015 Association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute and chronic pancreatitis: A case-control study from India.
26061016 2015 Quercetin Decreases Claudin-2 Expression Mediated by Up-Regulation of microRNA miR-16 in Lung Adenocarcinoma A549 Cells.
26023235 2015 Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins.
25948735 2015 Tumor necrosis factor-? induces a biphasic change in claudin-2 expression in tubular epithelial cells: role in barrier functions.
25823815 2015 Lyn modulates Claudin-2 expression and is a therapeutic target for breast cancer liver metastasis.
25694446 2015 PKC? interacts with Rab14 and modulates epithelial barrier function through regulation of claudin-2 levels.
25616664 2015 Autophagy enhances intestinal epithelial tight junction barrier function by targeting claudin-2 protein degradation.
More...