Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.80
PubTator Score 465.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.000

Synonym

Accession P57737 B4DFD6 B4DL18 I3L416 Q17RK4 Crn7
Symbols CRN7
POD1
0610011B16Rik

Gene

 GO Function (1)

Gene RIF (7)

PMID Text
25887538 Obese children had significantly lower methylation levels at a CpG site located near coronin 7 (CORO7), which encodes a tryptophan-aspartic acid dipeptide (WD)-repeat containing protein most likely involved in Golgi complex morphology and function
24768539 Results show that enforced targeting of Crn7 to TGN 9trans-Golgi network) bypasses the requirement of K33-ubiquitination for TGN-pool F-actin assembly and post-Golgi trafficking.
21130766 Data show that CRN7 interacted with Cullin1 and Roc1 to form a novel SCF-like E3 complex.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18581049 Sequential events of protein interaction and posttranslational modification result in the membrane targeting of Crn7.
16905771 Crn7 interacts with AP-1 and is required for the maintenance of Golgi morphology and protein export from the Golgi
15327992 role in the organization of intracellular membrane compartments and vesicular trafficking rather than in remodeling the cytoskeleton

AA Sequence

MNRFRVSKFRHTEARPPRRESWISDIRAGTAPSCRNHIKSSCSLIAFNSDRPGVLGIVPLQGQGEDKRRV      1 - 70
AHLGCHSDLVTDLDFSPFDDFLLATGSADRTVKLWRLPGPGQALPSAPGVVLGPEDLPVEVLQFHPTSDG     71 - 140
ILVSAAGTTVKVWDAAKQQPLTELAAHGDLVQSAVWSRDGALVGTACKDKQLRIFDPRTKPRASQSTQAH    141 - 210
ENSRDSRLAWMGTWEHLVSTGFNQMREREVKLWDTRFFSSALASLTLDTSLGCLVPLLDPDSGLLVLAGK    211 - 280
GERQLYCYEVVPQQPALSPVTQCVLESVLRGAALVPRQALAVMSCEVLRVLQLSDTAIVPIGYHVPRKAV    281 - 350
EFHEDLFPDTAGCVPATDPHSWWAGDNQQVQKVSLNPACRPHPSFTSCLVPPAEPLPDTAQPAVMETPVG    351 - 420
DADASEGFSSPPSSLTSPSTPSSLGPSLSSTSGIGTSPSLRSLQSLLGPSSKFRHAQGTVLHRDSHITNL    421 - 490
KGLNLTTPGESDGFCANKLRVAVPLLSSGGQVAVLELRKPGRLPDTALPTLQNGAAVTDLAWDPFDPHRL    491 - 560
AVAGEDARIRLWRVPAEGLEEVLTTPETVLTGHTEKICSLRFHPLAANVLASSSYDLTVRIWDLQAGADR    561 - 630
LKLQGHQDQIFSLAWSPDGQQLATVCKDGRVRVYRPRSGPEPLQEGPGPKGGRGARIVWVCDGRCLLVSG    631 - 700
FDSQSERQLLLYEAEALAGGPLAVLGLDVAPSTLLPSYDPDTGLVLLTGKGDTRVFLYELLPESPFFLEC    701 - 770
NSFTSPDPHKGLVLLPKTECDVREVELMRCLRLRQSSLEPVAFRLPRVRKEFFQDDVFPDTAVIWEPVLS    771 - 840
AEAWLQGANGQPWLLSLQPPDMSPVSQAPREAPARRAPSSAQYLEEKSDQQKKEELLNAMVAKLGNREDP    841 - 910
LPQDSFEGVDEDEWD                                                           911 - 925
//

Text Mined References (15)

PMID Year Title
25887538 2015 Implication of coronin 7 in body weight regulation in humans, mice and flies.
24768539 2014 K33-Linked Polyubiquitination of Coronin 7 by Cul3-KLHL20 Ubiquitin E3 Ligase Regulates Protein Trafficking.
21130766 2011 Coronin7 forms a novel E3 ubiquitin ligase complex to promote the degradation of the anti-proliferative protein Tob.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18581049 2008 Molecular mechanism underlying the association of Coronin-7 with Golgi membranes.
16905771 2006 Crn7 interacts with AP-1 and is required for the maintenance of Golgi morphology and protein export from the Golgi.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...