Property Summary

NCBI Gene PubMed Count 42
PubMed Score 58.53
PubTator Score 50.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Parkinson Disease 105
Disease Target Count P-value
non-small cell lung carcinoma 413 2.31365805560245E-21
intraductal papillary-mucinous adenoma (IPMA) 2956 1.95955398995907E-5
pancreatic cancer 2300 9.94203312182773E-5
interstitial cystitis 2299 5.37849986321565E-4
lung cancer 4473 7.75536115954033E-4
lung adenocarcinoma 2714 0.00137946503129225
ductal carcinoma in situ 1745 0.00196383584943202
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00266296126752656
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00303425445949109
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00895948526741725
invasive ductal carcinoma 2950 0.0120623553020346
spina bifida 1064 0.0495670204630674
Disease Target Count Z-score Confidence
Parkinson's disease 364 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.352 1.7

Expression

Synonym

Accession P57735 Q5VYA2 Q8NG24 Q96GB1 Q9BT12
Symbols CATX-8
RAB11C

Gene

PDB

2OIL   3TSO  

  Ortholog (8)

Gene RIF (19)

PMID Text
26535714 Rab25 expression is a potential prognostic index for advanced NSCLC patients and its inhibition may improve chemosensitization in NSCLC treatment.
25686498 These results showed that high levels of Rab25 expression were significantly correlated with renal cell carcinoma invasion classification (P < 0.01), lymph-node metastasis (P < 0.001), and pathological stage (P < 0.01).
24403269 High RAB25 expression is associated with good clinical outcome in patients with locally advanced head and neck squamous cell carcinoma.
24056041 the crystal structure of Rab25 in complex with the C-terminal region of FIP2, which consists of a central dimeric FIP2 coiled-coil that mediates a heterotetrameric Rab25-(FIP2)2-Rab25 complex.
23722651 Overexpression of Rab25 contributes to metastasis of bladder cancer through induction of epithelial-mesenchymal transition and activation of Akt/GSK-3beta/Snail signaling.
23345591 Rab25 controls intestinal cell polarity through the regulation of gene expression
23340300 These findings suggest that Rab25 plays an important role in tumor migration and metastasis, and that understanding its function may lead to the development of new strategies to prevent metastasis in oral cancer patients.
23176489 RAB25 has been implicated in various cancers, with reports presenting it as both an oncogene and a tumour-suppressor gene. [Review]
23030522 data showed Rab25 was highly expressed in all subtypes of epithelial ovarian cancers, and two subtypes of germ cell tumors, but not in sex cord stromal tumors; Rab25 expression was not correlated with peritoneal metastasis of ovarian cancer
22991305 Studies using lentiviral-based overexpression and suppression systems lent support of Rab25 to function as an important tumor suppressor with both anti-invasive and -angiogenic abilities, through a deregulated FAK-Raf-MEK1/2-ERK signaling pathway.
More...

AA Sequence

MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG      1 - 70
LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEA     71 - 140
RMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC    141 - 210
ISL                                                                       211 - 213
//

Text Mined References (44)

PMID Year Title
26535714 2015 Expression of Ras-related protein 25 predicts chemotherapy resistance and prognosis in advanced non-small cell lung cancer.
26032412 2015 Structure-Function Analyses of the Interactions between Rab11 and Rab14 Small GTPases with Their Shared Effector Rab Coupling Protein (RCP).
25686498 2015 Rab25 upregulation correlates with the proliferation, migration, and invasion of renal cell carcinoma.
25455994 2015 The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions.
25405658 2015 Rab25 is responsible for phosphoinositide 3-kinase/AKT?mediated cisplatin resistance in human epithelial ovarian cancer cells.
25339198 2015 Expression pattern of the PRDX2, RAB1A, RAB1B, RAB5A and RAB25 genes in normal and cancer cervical tissues.
24955142 2014 Exploration of panviral proteome: high-throughput cloning and functional implications in virus-host interactions.
24403269 2013 High RAB25 expression is associated with good clinical outcome in patients with locally advanced head and neck squamous cell carcinoma.
24056041 2013 Structural and functional analysis of FIP2 binding to the endosome-localised Rab25 GTPase.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
More...