Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.15
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
23948415 CARD18 may be both a promising marker for prognosis and a target protein for treatment of gastric cancer.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCC      1 - 70
KFIKHLCEEDPQLASKMGLH                                                       71 - 90
//

Text Mined References (8)

PMID Year Title
23948415 2013 [The expression of CARD18 in apoptin-transfected gastric cancer cells and gastric adenocarcinoma tissues].
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383541 2004 INCA, a novel human caspase recruitment domain protein that inhibits interleukin-1beta generation.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11821383 2002 CARD-8 protein, a new CARD family member that regulates caspase-1 activation and apoptosis.
11051551 2000 ICEBERG: a novel inhibitor of interleukin-1beta generation.