Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.10
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
Atopic dermatitis -2.200 1.4e-03

Gene RIF (3)

AA Sequence

MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCC      1 - 70
KFIKHLCEEDPQLASKMGLH                                                       71 - 90
//

Text Mined References (11)

PMID Year Title