Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 7
Funding $521,755.25
PubMed Score 27.42
PubTator Score 18.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis 1.400 0.002
glioblastoma 1.600 0.001
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.599 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.005
lung cancer -1.400 0.008
interstitial cystitis -2.100 0.000
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.300 0.000
nasopharyngeal carcinoma -1.400 0.000
lung carcinoma -1.900 0.000
ovarian cancer -2.700 0.000

Gene RIF (9)

PMID Text
26631737 Rab38 was associated with albuminuria in type 2 diabetes patients. Relative expression of RAB38 was higher in tubuli of patients with diabetic kidney disease compared with control subjects.
25324551 Rab38 and its close homolog Rab32 bind to Myosin Vc but not to Myosin Va or Myosin Vb. Binding depends on residues in the switch II region of Rab32 and Rab38 and regions of the Myosin Vc coiled-coil tail domain.
24875359 MiR-124 significantly decreases the H2O2-induced apoptosis of human hepatic L02 cells by targeting the Rab38 gene and activating the AKT pathway.
24026199 The expression levels of RAB38 were significantly associated with grade progression as well as prognosis in gliomas. RAB38 is an important prognostic biomarker and potential therapeutic target in gliomas.
23084991 BLOC-3 is a Rab32 and Rab38 guanine nucleotide exchange factor, with a specific function in the biogenesis of lysosome-related organelles.
22511774 that Rab38 and Rab32 are the specific factors that direct the ubiquitous machinery to mediate transport from early endosomes to maturing LROs.
20103624 Studies confirmed elevated expression of three target antigens RAB38, TBCE, and DUSP12 in CML.
18477474 Varp physically interacts with Rab38, and preferentially binds to the active GTP-bound form of Rab38 both in vitro and in vivo.
12850305 Not a new major locus for Japanese oculocutaneous albinisms.

AA Sequence

MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE      1 - 70
RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG     71 - 140
LKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAK    141 - 210
S//

Text Mined References (24)

PMID Year Title
26631737 2016 Genome-wide Association Studies Identify Genetic Loci Associated With Albuminuria in Diabetes.
25767741 Interaction with the effector dynamin-related protein 1 (Drp1) is an ancient function of Rab32 subfamily proteins.
25324551 2014 Myosin vc interacts with Rab32 and Rab38 proteins and works in the biogenesis and secretion of melanosomes.
24943344 2014 Frontotemporal dementia and its subtypes: a genome-wide association study.
24875359 2014 MiR-124 protects human hepatic L02 cells from H2O2-induced apoptosis by targeting Rab38 gene.
24026199 2013 RAB38 confers a poor prognosis, associated with malignant progression and subtype preference in glioma.
23084991 2012 BLOC-3 mutated in Hermansky-Pudlak syndrome is a Rab32/38 guanine nucleotide exchange factor.
22511774 2012 BLOC-2, AP-3, and AP-1 proteins function in concert with Rab38 and Rab32 proteins to mediate protein trafficking to lysosome-related organelles.
21269460 2011 Initial characterization of the human central proteome.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
More...