Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.86
PubTator Score 18.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 3.7e-05
Astrocytoma, Pilocytic 1.300 8.7e-07
glioblastoma 1.100 1.9e-05
interstitial cystitis -1.900 4.6e-04
intraductal papillary-mucinous adenoma (... 1.200 4.7e-03
lung cancer -1.400 8.1e-03
lung carcinoma -1.900 1.0e-29
malignant mesothelioma -2.100 2.5e-08
medulloblastoma, large-cell 1.200 7.2e-05
nasopharyngeal carcinoma -1.400 7.3e-07
non-small cell lung cancer 1.599 3.6e-12
ovarian cancer -2.700 3.2e-09
psoriasis 1.400 2.4e-03

Gene RIF (9)

AA Sequence

MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE      1 - 70
RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG     71 - 140
LKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAK    141 - 210
S//

Text Mined References (24)

PMID Year Title