Property Summary

NCBI Gene PubMed Count 41
Grant Count 2
Funding $58,833.62
PubMed Score 35.46
PubTator Score 50.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession P57727 D3DSJ6 Q5USC7 Q6ZMC3
Symbols DFNB8
DFNB10
ECHOS1
TADG12

Gene

 Grant Application (2)

Gene RIF (21)

PMID Text
26531004 Study demonstrated that TMPRSS3 contributes to ovarian cancer cell proliferation, invasion and metastasis, probably via activation of the ERK1/2 signaling pathway.
26191247 TMPRSS3 expression is an independent prognostic factor for breast cancer patients. Bioinformatic analysis of potential TMPRSS3 binding proteins revealed that TMPRSS3 could be a key regulator of cancer pathways.
26014348 Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival
25474651 homozygous mutation TMPRSS3: c.535G>A causes prelingual hearing loss in this Tibetan family
25029565 Single nucleotide polymorphisms in TMPRSS3 (rs3814903 and rs11203200) are significantly associated with breast cancer risk.
24526180 The prevalence of TMPRSS3 mutations among Korean postlingual hearing loss is 8.3 %. The p.A306T variant of TMPRSS3 is the common founder allele in Koreans. A novel variant, p.T248M of TMPRSS3, was predicted to have milder pathogenicity.
24416283 Description of the spectrum of mutations in TMPRSS3 in 374 families with autosomal recessive, non-syndromic hearing loss from India.
23958653 Association between TMPRSS3 genotypes and phenotype variants in autosomal recessive nonsyndromic hearing loss.
22446619 Data imply that TMPRSS3-A/D overexpression in EOC is probably due to hypomethylation of their control region.
22382023 TMPRSS3 gene is not a major contributor to non-syndromic deafness in the Moroccan population.
More...

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIH      1 - 70
FDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANV     71 - 140
ACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHR    141 - 210
RGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDN    211 - 280
PAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGA    281 - 350
GDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATS    351 - 420
FGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT                                        421 - 454
//

Text Mined References (40)

PMID Year Title
26531004 2016 TMPRSS3 modulates ovarian cancer cell proliferation, invasion and metastasis.
26191247 2015 TMPRSS3 is a novel poor prognostic factor for breast cancer.
26014348 2015 Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival.
25474651 2014 Identification of a novel homozygous mutation, TMPRSS3: c.535G>A, in a Tibetan family with autosomal recessive non-syndromic hearing loss.
25029565 2014 Type II transmembrane serine protease gene variants associate with breast cancer.
24526180 2014 A novel mutation of TMPRSS3 related to milder auditory phenotype in Korean postlingual deafness: a possible future implication for a personalized auditory rehabilitation.
24416283 2014 Non-syndromic hearing impairment in India: high allelic heterogeneity among mutations in TMPRSS3, TMC1, USHIC, CDH23 and TMIE.
23958653 2013 Genetic analysis of TMPRSS3 gene in the Korean population with autosomal recessive nonsyndromic hearing loss.
22446619 2012 A novel genome-based approach correlates TMPRSS3 overexpression in ovarian cancer with DNA hypomethylation.
22382023 2012 Molecular analysis of the TMPRSS3 gene in Moroccan families with non-syndromic hearing loss.
More...