Property Summary

NCBI Gene PubMed Count 44
PubMed Score 28.01
PubTator Score 50.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.304 1.6e-02
active ulcerative colitis 3.345 1.3e-02
Astrocytoma, Pilocytic -1.100 2.7e-03
Breast cancer -1.600 3.3e-03
colon cancer 2.000 1.4e-02
esophageal adenocarcinoma 2.700 1.8e-02
intraductal papillary-mucinous adenoma (... 1.500 6.8e-03
intraductal papillary-mucinous carcinoma... 1.300 4.6e-02
intraductal papillary-mucinous neoplasm ... 2.900 2.6e-03
nasopharyngeal carcinoma -1.100 4.6e-03
osteosarcoma -1.233 6.1e-07
ovarian cancer 1.100 5.6e-04
pancreatic cancer 2.000 5.0e-06
pituitary cancer -1.500 3.7e-05
psoriasis -1.900 1.3e-04
spina bifida -1.480 3.5e-02

Gene RIF (24)

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIH      1 - 70
FDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANV     71 - 140
ACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHR    141 - 210
RGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDN    211 - 280
PAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGA    281 - 350
GDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATS    351 - 420
FGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT                                        421 - 454
//

Text Mined References (43)

PMID Year Title