Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.92
PubTator Score 21.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma -1.300 2.9e-07
group 3 medulloblastoma 2.000 1.1e-03
medulloblastoma, large-cell 1.600 3.4e-03
lung cancer 1.200 1.7e-04

Protein-protein Interaction (4)

Gene RIF (4)

PMID Text
26196957 PCBP4 plays important roles in the induction of cisplatin resistance in human maxillary cancers.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17973258 expression of alpha CP-4 can inhibit proliferation and tumorigenesis of lung cancer cells, both in vivo and in vitro, by delaying the progression of the cell cycle

AA Sequence

MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTA      1 - 70
AVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD     71 - 140
LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTP    141 - 210
AEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQ    211 - 280
AEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPY    281 - 350
AISLSNFIGLKPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY                     351 - 403
//

Text Mined References (20)

PMID Year Title
26196957 2015 Suppression of Poly(rC)-Binding Protein 4 (PCBP4) reduced cisplatin resistance in human maxillary cancer cells.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20817677 2011 The cyclin-dependent kinase inhibitor p21 is regulated by RNA-binding protein PCBP4 via mRNA stability.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17973258 2008 Expression of alpha CP-4 inhibits cell cycle progression and suppresses tumorigenicity of lung cancer cells.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205328 2004 Alpha CP-4, encoded by a putative tumor suppressor gene at 3p21, but not its alternative splice variant alpha CP-4a, is underexpressed in lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612387 2003 A novel set of nuclear localization signals determine distributions of the alphaCP RNA-binding proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12003487 2002 The poly(C)-binding proteins: a multiplicity of functions and a search for mechanisms.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11313928 2001 Regulation of the G2/M transition by p53.
10936052 2000 Identification of two novel mammalian genes establishes a subfamily of KH-domain RNA-binding proteins.
10891498 2000 MCG10, a novel p53 target gene that encodes a KH domain RNA-binding protein, is capable of inducing apoptosis and cell cycle arrest in G(2)-M.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.