Property Summary

NCBI Gene PubMed Count 20
PubMed Score 23.09
PubTator Score 21.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.2e-06
lung cancer 4740 1.7e-04
group 3 medulloblastoma 4104 1.1e-03
medulloblastoma, large-cell 6241 3.4e-03
Disease Target Count Z-score Confidence
Vulvovaginal candidiasis 5 3.622 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 1.2e-06
group 3 medulloblastoma 2.000 1.1e-03
lung cancer 1.200 1.7e-04
medulloblastoma, large-cell 1.600 3.4e-03

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTA      1 - 70
AVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD     71 - 140
LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTP    141 - 210
AEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQ    211 - 280
AEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPY    281 - 350
AISLSNFIGLKPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY                     351 - 403
//

Text Mined References (20)

PMID Year Title