Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.71
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 2.9e-41
malignant mesothelioma 3232 1.7e-06
sonic hedgehog group medulloblastoma 467 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.7
Type 2 diabetes mellitus 272 0.0 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma 2.200 2.9e-41
malignant mesothelioma -1.600 1.7e-06
sonic hedgehog group medulloblastoma 1.100 1.8e-02

Gene RIF (2)

AA Sequence

MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKK      1 - 70
MREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQ     71 - 140
CGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPY    141 - 210
RPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNL    211 - 280
MGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANI    281 - 350
SLAQYLINARLTSEVTGMGTL                                                     351 - 371
//

Text Mined References (15)

PMID Year Title