Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
Funding $765,477.35
PubMed Score 4.59
PubTator Score 3.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
sonic hedgehog group medulloblastoma 1.100 0.018
lung carcinoma 2.200 0.000

Gene RIF (2)

PMID Text
23333304 HIV-1 Vif downregulates the expression of poly(rC) binding protein 3 (PCBP3) in Vif-expression T cells
19914360 Study examined splicing factors located on chromosome 21 for their effect on tau exon 10 and discovered that one of them, hnRNPE3 (PCBP3), modestly activates splicing of exon 10 by interacting with its proximal downstream intron around position +19.

AA Sequence

MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKK      1 - 70
MREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQ     71 - 140
CGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPY    141 - 210
RPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNL    211 - 280
MGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANI    281 - 350
SLAQYLINARLTSEVTGMGTL                                                     351 - 371
//

Text Mined References (15)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
19914360 2010 Heterogeneous nuclear ribonucleoprotein E3 modestly activates splicing of tau exon 10 via its proximal downstream intron, a hotspot for frontotemporal dementia mutations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612387 2003 A novel set of nuclear localization signals determine distributions of the alphaCP RNA-binding proteins.
More...