Property Summary

NCBI Gene PubMed Count 34
Grant Count 4
R01 Count 2
Funding $631,804
PubMed Score 16.57
PubTator Score 24.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
cutaneous lupus erythematosus -1.300 0.032
psoriasis 1.500 0.000
osteosarcoma -2.579 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.300 0.000
colon cancer 1.300 0.011
group 3 medulloblastoma 1.700 0.000
ovarian cancer 1.300 0.000

Synonym

Accession P57678 Q9NZS7 Q9UG32 Q9Y4Q2 Gemin-4
Symbols p97
HC56
HCAP1
HHRF-1

Gene

Gene RIF (15)

PMID Text
25555524 These findings indicate that GEMIN4 functions as a novel coregulator of the MR.
22506892 the association between the GEMIN4 gene and the risk of prostate cancer
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 4 (GEMIN4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20211803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MDLGPLNICEEMTILHGGFLLAEQLFHPKALAELTKSDWERVGRPIVEALREISSAAAHSQPFAWKKKAL      1 - 70
IIIWAKVLQPHPVTPSDTETRWQEDLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAE     71 - 140
LERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAMAHKYLPALDEFPHPPKRLRSDPDAC    141 - 210
PTMPLLAMLLRGLTQIQSRILGPGRKCCALANLADMLTVFALTEDDPQEVSATVYLDKLATVISVWNSDT    211 - 280
QNPYHQQALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLRSSQGTSYDSYRLCD    281 - 350
SLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHME    351 - 420
VCYIFASEKKWAFSDEWVACLGSNRALFRQPDLVLRLLETVIDVSTADRAIPESQIRQVIHLILECYADL    421 - 490
SLPGKNKVLAGILRSWGRKGLSEKLLAYVEGFQEDLNTTFNQLTQSASEQGLAKAVASVARLVIVHPEVT    491 - 560
VKKMCSLAVVNLGTHKFLAQILTAFPALRFVEEQGPNSSATFMVSCLKETVWMKFSTPKEEKQFLELLNC    561 - 630
LMSPVKPQGIPVAALLEPDEVLKEFVLPFLRLDVEEVDLSLRIFIQTLEANACREEYWLQTCSPFPLLFS    631 - 700
LCQLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTV    701 - 770
GLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDV    771 - 840
GNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQ    841 - 910
LSVLFLRTFQFLCSHSCRDWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYT    911 - 980
QVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQT    981 - 1050
LLQKMSSF                                                                 1051 - 1058
//

Text Mined References (39)

PMID Year Title
25555524 2015 GEMIN4 functions as a coregulator of the mineralocorticoid receptor.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22506892 2012 Genetic variants in the microRNA machinery gene GEMIN4 are associated with risk of prostate cancer: a case-control study of the Chinese Han population.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
More...