Property Summary

NCBI Gene PubMed Count 19
PubMed Score 41.78
PubTator Score 17.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
juvenile dermatomyositis 1.009 1.6e-03
medulloblastoma, large-cell -1.400 6.8e-04
osteosarcoma 2.148 2.1e-08
ovarian cancer -1.100 1.7e-08
pancreatic ductal adenocarcinoma liver m... -1.651 8.3e-04
Pick disease 1.300 1.8e-05

Gene RIF (5)

AA Sequence

MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG      1 - 70
QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR     71 - 140
YRQQL                                                                     141 - 145
//

Text Mined References (19)

PMID Year Title