Property Summary

NCBI Gene PubMed Count 30
PubMed Score 53.26
PubTator Score 38.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Seizures 95
Status Epilepticus 85
Disease Target Count P-value
ependymoma 2514 6.56619083170435E-11
atypical teratoid / rhabdoid tumor 4369 7.7150506705721E-7
medulloblastoma, large-cell 6234 1.82669819473693E-4
osteosarcoma 7933 7.52838696239131E-4
sonic hedgehog group medulloblastoma 1482 0.00118403570503149
pediatric high grade glioma 2712 0.00610085215657237
glioblastoma 5572 0.00670581929222165
acute myeloid leukemia 785 0.0120238295148992
pituitary cancer 1972 0.0251354367784052
primitive neuroectodermal tumor 3031 0.0406588487546824
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Globe disease 57 0.0 1.0
Disease Target Count Z-score Confidence
Brain Ischemia 87 4.081 2.0
Schnyder Corneal Dystrophy 24 4.026 2.0
Disease Target Count
cystic fibrosis 1670

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.500 0.007
osteosarcoma 1.264 0.001
ependymoma -2.100 0.000
sonic hedgehog group medulloblastoma -1.800 0.001
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.500 0.041
pediatric high grade glioma -1.100 0.006
acute myeloid leukemia -2.100 0.012
pituitary cancer 1.300 0.025

Synonym

Accession P57103 Q5K3P6 Q5K3P7 Q8IUE9 Q8IUF0 Q8NFI7 Q96QG1 Q96QG2
Symbols NCX3

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (16)

PMID Text
23919677 Ayloid beta mediates calpain cleavage of NCX3 in Alzheimer's disease brain.
23224891 human macrophages and monocytes express NCX1 and NCX3 that operate in a bidirectional manner to restore [Ca(2+)](i) to generate Ca(2+) signals and to induce TNF-alpha production.
23224890 Functional studies, as well as mRNA and protein expression analyses, revealed that NCX1 and NCX3, but not NCX2, were divergently modulated during OPC differentiation into oligodendrocyte.
23224887 the large cytosolic loop of NCX1, NCX2, and NCX3 is involved in acquisition of immunosuppressive drug specificity
23224884 NCX isoforms (NCX2, NCX3) contribute to mitochondrial Na(+)/Ca(2+) exchange in human DAergic neurons and may act downstream of PINK1 in the prevention of neurodegeneration by m[Ca(2+)] accumulation.
23224883 NCX1 and NCX3 -represent two promising druggable targets for setting on new strategies in stroke therapy.
21959935 calcium signaling mediated by NCX3 has a crucial role in oligodendrocyte maturation and myelin formation.
21858195 Data suggest that NCX-mediated Ca(2+) fluxes normally exist in human ASM (potentially contributing to rapid Ca(2+) fluxes), and contribute to enhanced [Ca(2+)](i) regulation in airway inflammation.
21790537 Human platelets express K(+) -independent Na(+) /Ca(2+) exchangers NCX1.3, NCX3.2 and NCX3.4.
21382638 Results demonstrate a selective regulation of NCX1, NCX2 and NCX3 isoforms in Alzheimer's disease cortex, specifically in terminals containing amyloid-beta.
More...

AA Sequence

MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVILPIWYPENPSL      1 - 70
GDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMA     71 - 140
LGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWS    141 - 210
IFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGD    211 - 280
HPKGIEMDGKMMNSHFLDGNLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKS    281 - 350
RAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR    351 - 420
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIE    421 - 490
EEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARG    491 - 560
TVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISA    561 - 630
LLLSPDVTDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRD    631 - 700
QFMEAITVSAAGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTA    701 - 770
IIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW    771 - 840
SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWL    841 - 910
LYILFATLEAYCYIKGF                                                         911 - 927
//

Text Mined References (34)

PMID Year Title
23919677 2014 Calpain cleavage and inactivation of the sodium calcium exchanger-3 occur downstream of A? in Alzheimer's disease.
23506867 The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23224891 2013 Human macrophages and monocytes express functional Na(+)/Ca (2+) exchangers 1 and 3.
23224890 2013 New roles of NCX in glial cells: activation of microglia in ischemia and differentiation of oligodendrocytes.
23224887 2013 Immunosuppressive drugs, immunophilins, and functional expression of NCX isoforms.
23224884 2013 The role of the mitochondrial NCX in the mechanism of neurodegeneration in Parkinson's disease.
23224883 2013 NCX as a key player in the neuroprotection exerted by ischemic preconditioning and postconditioning.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
21959935 2012 Silencing or knocking out the Na(+)/Ca(2+) exchanger-3 (NCX3) impairs oligodendrocyte differentiation.
More...