Property Summary

NCBI Gene PubMed Count 31
PubMed Score 72.34
PubTator Score 38.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -2.100 1.2e-02
atypical teratoid / rhabdoid tumor -2.200 7.7e-07
ependymoma -2.100 6.6e-11
glioblastoma -1.200 2.2e-03
group 3 medulloblastoma -1.300 1.2e-02
medulloblastoma, large-cell -2.300 1.8e-04
osteosarcoma 1.264 7.5e-04
pediatric high grade glioma -1.100 6.1e-03
pituitary cancer 1.300 2.5e-02
primitive neuroectodermal tumor -1.500 4.1e-02

Protein-protein Interaction (5)

Gene RIF (17)

AA Sequence

MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVILPIWYPENPSL      1 - 70
GDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMA     71 - 140
LGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWS    141 - 210
IFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGD    211 - 280
HPKGIEMDGKMMNSHFLDGNLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKS    281 - 350
RAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR    351 - 420
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIE    421 - 490
EEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARG    491 - 560
TVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISA    561 - 630
LLLSPDVTDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRD    631 - 700
QFMEAITVSAAGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTA    701 - 770
IIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW    771 - 840
SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWL    841 - 910
LYILFATLEAYCYIKGF                                                         911 - 927
//

Text Mined References (35)

PMID Year Title