Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.95
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRL      1 - 70
HQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLP     71 - 140
LLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNE    141 - 210
LRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP                                     211 - 247
//

Text Mined References (12)

PMID Year Title