Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.95
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P57088 B3KSS8 Q9H953
Symbols SHINC3
SHINC-3
1600019D15Rik

Gene

Gene RIF (2)

PMID Text
26268696 TMEM33 is a novel regulator of the PERK-eIE2alpha-ATF4 and IRE1-XBP1 axes of the UPR signaling.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of transmembrane protein 33 (TMEM33) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRL      1 - 70
HQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLP     71 - 140
LLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNE    141 - 210
LRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP                                     211 - 247
//

Text Mined References (12)

PMID Year Title
26268696 2015 TMEM33: a new stress-inducible endoplasmic reticulum transmembrane protein and modulator of the unfolded protein response signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...