Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.57
PubTator Score 11.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
gastric carcinoma 1.200 2.6e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-04
Multiple myeloma 1.046 1.7e-02
osteosarcoma 1.442 4.0e-05
ovarian cancer 2.200 3.6e-06
psoriasis 2.400 1.3e-05

Synonym

Accession P57086 Q6IAG7
Symbols RAZ1
SDP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA      1 - 70
ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD     71 - 140
IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG                                   141 - 179
//

Text Mined References (17)

PMID Year Title