Property Summary

NCBI Gene PubMed Count 16
PubMed Score 17.59
PubTator Score 11.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.43308527661493E-6
psoriasis 6685 1.25441445280618E-5
osteosarcoma 7933 3.97521596054924E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.67792538584899E-4
Multiple myeloma 1328 0.0171254181978324
gastric carcinoma 832 0.0264381274815551
Disease Target Count Z-score Confidence
Botulism 20 3.918 2.0
Pneumothorax 17 3.036 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.046 0.017
psoriasis 2.400 0.000
osteosarcoma 1.442 0.000
intraductal papillary-mucinous neoplasm ... -1.400 0.000
gastric carcinoma 1.200 0.026
ovarian cancer 2.300 0.000

Synonym

Accession P57086 Q6IAG7
Symbols RAZ1
SDP1

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
18660489 Observational study of gene-disease association. (HuGE Navigator)
16540086 This result indicates that NY-REN-21 can function either as a homodimer or as a heterodimer with SCAND1.

AA Sequence

MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA      1 - 70
ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD     71 - 140
IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG                                   141 - 179
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16540086 2006 Spectroscopic characterization of the tumor antigen NY-REN-21 and identification of heterodimer formation with SCAND1.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444922 2003 SDP1 is a peroxisome-proliferator-activated receptor gamma 2 co-activator that binds through its SCAN domain.
12383503 2002 Characterization of the SCAN box encoding RAZ1 gene: analysis of cDNA transcripts, expression, and cellular localization.
More...