Property Summary

NCBI Gene PubMed Count 21
PubMed Score 49.06
PubTator Score 27.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Ischiopatellar dysplasia 1 0.0 0.0
Disease Target Count P-value
non-small cell lung carcinoma 317 4.1e-24
lung adenocarcinoma 2716 2.2e-11
lung carcinoma 2843 6.2e-11
lung cancer 4740 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.300 2.2e-11
lung cancer -1.400 2.3e-03
lung carcinoma -1.800 6.2e-11
non-small cell lung carcinoma -1.500 4.1e-24

Gene RIF (13)

AA Sequence

MLQDKGLSESEEAFRAPGPALGEASAANAPEPALAAPGLSGAALGSPPGPGADVVAAAAAEQTIENIKVG      1 - 70
LHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKA     71 - 140
EPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSK    141 - 210
NTAFCTHVFPETSFISVTSYQNHKITQLKIENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLI    211 - 280
SPQLSATPDVGPLLGTHQALQHYQHENGAHSQLAEPQDLPLSTFPTQRDSSLFYHCLKRRDGTRHLDLPC    281 - 350
KRSYLEAPSSVGEDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSGSGPEIAGVSGVDDLPPPPLSCNMW    351 - 420
TSVSPYTSYSVQTMETVPYQPFPTHFTATTMMPRLPTLSAQSSQPPGNAHFSVYNQLSQSQVRERGPSAS    421 - 490
FPRERGLPQGCERKPPSPHLNAANEFLYSQTFSLSRESSLQYHSGMGTVENWTDG                   491 - 545
//

Text Mined References (24)

PMID Year Title