Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.34
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.21289762651943E-31
acute quadriplegic myopathy 1157 1.46610165529349E-7
ovarian cancer 8492 1.9607420434999E-6
Atopic dermatitis 944 4.60451406543261E-4
osteosarcoma 7933 4.71368958193376E-4
medulloblastoma, large-cell 6234 0.00243674648865253
invasive ductal carcinoma 2950 0.0162152513263716
astrocytic glioma 2241 0.0214287611877687
Disease Target Count Z-score Confidence
Seckel syndrome 35 4.218 2.1
Down syndrome 548 3.674 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 0.021
osteosarcoma -2.415 0.000
medulloblastoma, large-cell 1.200 0.002
acute quadriplegic myopathy 1.299 0.000
Atopic dermatitis 1.300 0.000
psoriasis 1.400 0.000
invasive ductal carcinoma 1.100 0.016
ovarian cancer 2.200 0.000

Synonym

Accession P57081 A8KA58 B2RCA3 B4DNQ7 D3DSK3 Q9BVM5 Q9HCR3
Symbols TRM82
TRMT82

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (2)

PMID Text
26751069 regulates FEN1's potential DNA cleavage threat near the site of replication
26416026 Combined autozygome/exome analysis revealed a novel missense mutation in WDR4 as the likely causal variant of Primordial dwarfism

AA Sequence

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFS      1 - 70
KSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRL     71 - 140
ELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGD    141 - 210
GTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQL    211 - 280
VYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS    281 - 350
AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC            351 - 412
//

Text Mined References (21)

PMID Year Title
26751069 2016 Wuho Is a New Member in Maintaining Genome Stability through its Interaction with Flap Endonuclease 1.
26416026 2015 Mutation in WDR4 impairs tRNA m(7)G46 methylation and causes a distinct form of microcephalic primordial dwarfism.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...