Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.71
PubTator Score 2.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.299 1.5e-07
astrocytic glioma -1.500 2.1e-02
Atopic dermatitis 1.300 4.6e-04
invasive ductal carcinoma 1.100 1.6e-02
medulloblastoma, large-cell 1.200 2.4e-03
osteosarcoma 1.158 3.9e-06
ovarian cancer 2.200 2.0e-06
psoriasis 1.400 8.2e-31

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFS      1 - 70
KSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRL     71 - 140
ELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGD    141 - 210
GTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQL    211 - 280
VYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS    281 - 350
AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC            351 - 412
//

Text Mined References (22)

PMID Year Title