Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $305,099.25
PubMed Score 7.34
PubTator Score 2.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 0.021
osteosarcoma -2.415 0.000
medulloblastoma, large-cell 1.200 0.002
acute quadriplegic myopathy 1.299 0.000
Atopic dermatitis 1.300 0.000
psoriasis 1.400 0.000
invasive ductal carcinoma 1.100 0.016
ovarian cancer 2.200 0.000

Gene RIF (2)

PMID Text
26751069 regulates FEN1's potential DNA cleavage threat near the site of replication
26416026 Combined autozygome/exome analysis revealed a novel missense mutation in WDR4 as the likely causal variant of Primordial dwarfism

AA Sequence

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFS      1 - 70
KSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRL     71 - 140
ELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGD    141 - 210
GTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQL    211 - 280
VYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS    281 - 350
AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC            351 - 412
//

Text Mined References (21)

PMID Year Title
26751069 2016 Wuho Is a New Member in Maintaining Genome Stability through its Interaction with Flap Endonuclease 1.
26416026 2015 Mutation in WDR4 impairs tRNA m(7)G46 methylation and causes a distinct form of microcephalic primordial dwarfism.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...