Property Summary

NCBI Gene PubMed Count 26
Grant Count 9
R01 Count 4
Funding $589,182.17
PubMed Score 89.67
PubTator Score 28.64

Knowledge Summary

Patent (14,331)

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.113 0.001
cystic fibrosis -1.020 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
non-small cell lung cancer 1.011 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.003
interstitial cystitis -2.700 0.000
Breast cancer -2.000 0.000
spina bifida -1.614 0.049
ovarian cancer 1.100 0.005
pituitary cancer -2.400 0.000
chronic rhinosinusitis -1.272 0.044

Synonym

Accession P57078 Q96KH0
Symbols DIK
PKK
PPS2
RIP4
ANKK2
NKRD3
ANKRD3

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (16)

PMID Text
26129644 CHAND and Bartsocas-Papas syndrome might be allelic disorders or RIPK4 mutations could confer varying degrees of phenotypic severity, depending on their localization within or outside functionally important domains.
25784454 The p.Ser376X mutation in RIPK4 impaired its induction of IRF6 transactivator function.
25285922 The protein kinase C-associated kinase (PKK), which is also known as the receptor-interacting protein kinase 4, is a suppressor of tumor growth in squamous cell carcinoma of the skin.
25246526 Ser-413 and Ser-424 in IRF6 are important for its activation by RIPK4
25134534 we identified an epithelial ovarian cancer susceptibility loci at 10p11.21 (rs1192691 near ANKRD30A, P(meta) = 2.62 x 10(-8))
25096806 Suppression of PKK expression by RNA interference inhibits phosphorylation of IKKalpha and IKKbeta as well as activation of NF-kappaB in human cancer cell lines; thus, PKK regulates NF-kappaB activation by modulating activation of IKKalpha and IKKbeta.
24519546 Authors found a correlation between RIPK4 expression and TSCC degree of differentiation, age, and gender.
24413083 Data indicate protein-serine-threonine kinases RIPK4 overexpression in transformed fetal hepatocytes.
23371553 phosphorylation of DVL2 by RIPK4 favored canonical Wnt signaling; findings suggest that RIPK4 overexpression may contribute to the growth of certain tumor types
22197488 The present study's findings show that recessive mutations in RIPK4 cause Bartsocas-Papas syndrome and its variant, the autosomal-recessive form of multiple pterygium syndrome (Aslan type).
More...

AA Sequence

MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEA      1 - 70
KKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLL     71 - 140
HLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFA    141 - 210
IVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNG    211 - 280
LNGELIRQVLAALLPVTGRWRSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLD    281 - 350
VKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLS    351 - 420
GVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALDSGASLL    421 - 490
HLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAA    491 - 560
QNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGH    561 - 630
LPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTST    631 - 700
ARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEEL    701 - 770
VSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT            771 - 832
//

Text Mined References (28)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26129644 2015 Identification of a novel mutation in RIPK4 in a kindred with phenotypic features of Bartsocas-Papas and CHAND syndromes.
25784454 2015 Disease-associated mutations in IRF6 and RIPK4 dysregulate their signalling functions.
25285922 2015 PKK suppresses tumor growth and is decreased in squamous cell carcinoma of the skin.
25246526 2014 Receptor-interacting protein kinase 4 and interferon regulatory factor 6 function as a signaling axis to regulate keratinocyte differentiation.
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
25096806 2014 Protein kinase C-associated kinase regulates NF-?B activation through inducing IKK activation.
24519546 2014 RIPK4 is downregulated in poorly differentiated tongue cancer and is associated with migration/invasion and cisplatin-induced apoptosis.
24413083 2015 Retroviral insertional mutagenesis in telomerase-immortalized hepatocytes identifies RIPK4 as novel tumor suppressor in human hepatocarcinogenesis.
23371553 2013 Phosphorylation of Dishevelled by protein kinase RIPK4 regulates Wnt signaling.
More...