Property Summary

NCBI Gene PubMed Count 12
PubMed Score 36.52
PubTator Score 1.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 1.2e-04

AA Sequence

MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI      1 - 70
EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK     71 - 140
DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK    141 - 210
NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH    211 - 280
GVKDIKWRPR                                                                281 - 290
//

Text Mined References (12)

PMID Year Title