Property Summary

NCBI Gene PubMed Count 34
PubMed Score 216.40
PubTator Score 62.43

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.047
osteosarcoma -2.857 0.000
interstitial cystitis 1.200 0.001
psoriasis 1.400 0.000


Accession P57075 G5E9E4 Q6HA34 Q6HA35 Q6ISI6 Q6ISK3 Q6ISS9
Symbols TULA




  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (18)

25876712 A negative correlation was found between UBASH3A mRNA expression and systemic lupus erythematosus.
25843625 Findings suggest that UBASH3A gene might contribute to systemic lupus erythematosus susceptibility and influence the clinical phenotype of the disease.
25211447 these results have suggested that the allele A of two SNPs may play no role in the pathogenesis of autoimmune thyroid disease or that its effect may be confounded by other various factors.
25075402 Addition of PTPN22 and UBASH3A SNPs to HLA-DR,DQ genotyping can improve type 1 diabetes risk prediction.
23565265 Results suggest that UBASH3a gene plays a role in the susceptibility to systemic lupus erythematosus and UBASH3a can be considered as a common genetic factor in autoimmune diseases.
22776074 ubiquitin associated and SH3 domain containing A appears to be an independent predictor of islet autoimmunity and type 1 diabetes in children, including those free of family history of T1D but carrying the HLA-DR3/4,DQB1*0302 genotype
20647273 Observational study of gene-disease association. (HuGE Navigator)
20494980 The UBASH3A promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.
20410501 Observational study of gene-disease association. (HuGE Navigator)
19073967 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

EGKWELVNPPVKTLTHGANAAFNWRNWISGN                                           631 - 661

Text Mined References (36)

PMID Year Title
25876712 2015 Decreased UBASH3A mRNA Expression Levels in Peripheral Blood Mononuclear Cells from Patients with Systemic Lupus Erythematosus.
25843625 2015 Association of UBASH3A gene polymorphisms and systemic lupus erythematosus in a Chinese population.
25416956 2014 A proteome-scale map of the human interactome network.
25211447 2014 Lack of association between polymorphisms in the UBASH3A gene and autoimmune thyroid disease: a case control study.
25075402 2014 Improving prediction of type 1 diabetes by testing non-HLA genetic variants in addition to HLA markers.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23565265 2013 Evidence of new risk genetic factor to systemic lupus erythematosus: the UBASH3A gene.
22776074 2012 rs11203203 is associated with type 1 diabetes risk in population pre-screened for high-risk HLA-DR,DQ genotypes.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21516116 2011 Next-generation sequencing to generate interactome datasets.