Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.28
PubTator Score 17.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.600 1.8e-02
Astrocytoma, Pilocytic 2.200 6.5e-08
atypical teratoid / rhabdoid tumor -1.300 3.9e-02
Breast cancer -1.700 3.0e-07
breast carcinoma -1.400 4.4e-03
ependymoma -1.600 4.5e-03
group 3 medulloblastoma -3.200 2.0e-04
invasive ductal carcinoma -1.294 8.9e-03
medulloblastoma, large-cell -3.400 8.9e-05
oligodendroglioma 3.100 5.6e-03
Pick disease -1.100 2.8e-02
psoriasis -1.100 2.4e-03
subependymal giant cell astrocytoma -3.138 9.2e-03

Synonym

Accession P57073 Q9NZW2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MLDMSEARSQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGVAVGGARGDPAEAADERFPACIRD      1 - 70
AVSQVLKGYDWSLVPMPVRGGGGGALKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLW     71 - 140
RLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD    141 - 210
GHHHGDHTGQTHGPPTPPTTPKTELQQAGAKPELKLEGRRPVDSGRQNIDFSNVDISELSSEVMGTMDAF    211 - 280
DVHEFDQYLPLGGPAPPEPGQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGD    281 - 350
QPRGSPDYGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLL    351 - 420
NGLALPPAHSPTSHWDQPVYTTLTRP                                                421 - 446
//

Text Mined References (18)

PMID Year Title