Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
lung carcinoma 2844 3.80351998184942E-12
psoriasis 6685 7.49029809431467E-5


  Differential Expression (2)

Disease log2 FC p
psoriasis -1.600 0.000
lung carcinoma 1.100 0.000


Accession P57060
Symbols GL011




  Ortholog (11)

 Compartment GO Term (0)

Gene RIF (1)

20494980 The RWDD2B distal promoter contains an activating cis-regulatory element that is responsive to Trichostatin A (TSA) treatment and to serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

VFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ                                   281 - 319

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.