Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 3.8e-12
psoriasis 6694 7.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.100 3.8e-12
psoriasis -1.600 7.5e-05

Gene RIF (1)

AA Sequence

MKIELSMQPWNPGYSSEGATAQETYTCPKMIEMEQAEAQLAELDLLASMFPGENELIVNDQLAVAELKDC      1 - 70
IEKKTMEGRSSKVYFTINMNLDVSDEKMAMFSLACILPFKYPAVLPEITVRSVLLSRSQQTQLNTDLTAF     71 - 140
LQKHCHGDVCILNATEWVREHASGYVSRDTSSSPTTGSTVQSVDLIFTRLWIYSHHIYNKCKRKNILEWA    141 - 210
KELSLSGFSMPGKPGVVCVEGPQSACEEFWSRLRKLNWKRILIRHREDIPFDGTNDETERQRKFSIFEEK    211 - 280
VFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ                                   281 - 319
//

Text Mined References (16)

PMID Year Title