Property Summary

NCBI Gene PubMed Count 14
PubMed Score 24.42
PubTator Score 14.78

Knowledge Summary

Patent (9,281)

Expression

  Differential Expression (5)

Gene RIF (6)

PMID Text
25515931 Our findings indicate that therapeutically targeting HUNK is a potential strategy for overcoming resistance and that resistant breast cancer cells maintain HUNK expression to drive tumorigenesis
21393859 Hunk is required for HER2/neu-induced mammary tumorigenesis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20133759 Data show that HUNK reconstitution in basal breast cancer cell lines prevented protein phosphatase 2-A (PP2A from binding to CFL-1.
19717424 a gene expression signature that distinguishes Hunk-wild type from Hunk-deficient tumors predicts clinical outcome in women with breast cancer
15575376 Overproduction of MAK-V/Hunk in human breast cancer may be used fore more precise molecular typing.

AA Sequence

MPAAAGDGLLGEPAAPGGGGGAEDAARPAAACEGSFLPAWVSGVPRERLRDFQHHKRVGNYLIGSRKLGE      1 - 70
GSFAKVREGLHVLTGEKVAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVM     71 - 140
ELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRAGVVHRDLKIENLLLDEDNNIKLIDFGLSNC    141 - 210
AGILGYSDPFSTQCGSPAYAAPELLARKKYGPKIDVWSIGVNMYAMLTGTLPFTVEPFSLRALYQKMVDK    211 - 280
EMNPLPTQLSTGAISFLRSLLEPDPVKRPNIQQALANRWLNENYTGKVPCNVTYPNRISLEDLSPSVVLH    281 - 350
MTEKLGYKNSDVINTVLSNRACHILAIYFLLNKKLERYLSGKSDIQDSLCYKTRLYQIEKYRAPKESYEA    351 - 420
SLDTWTRDLEFHAVQDKKPKEQEKRGDFLHRPFSKKLDKNLPSHKQPSGSLMTQIQNTKALLKDRKASKS    421 - 490
SFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVR    491 - 560
SFESVDRDDHVEVLSPSHHYRILNSPVSLARRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSP    561 - 630
PKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPV    631 - 700
NLAFDMADGVKTQC                                                            701 - 714
//

Text Mined References (15)

PMID Year Title
25515931 2015 Regulation of cell survival by HUNK mediates breast cancer resistance to HER2 inhibitors.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
21393859 2011 Hunk is required for HER2/neu-induced mammary tumorigenesis.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20133759 2010 HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1.
19890347 2010 Genome-wide association study of generalized vitiligo in an isolated European founder population identifies SMOC2, in close proximity to IDDM8.
19717424 2009 The Snf1-related kinase, Hunk, is essential for mammary tumor metastasis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
15575376 [Proteinkinase MAK-V/Hunk as a possible dianostic and prognostic marker of human breast carcinoma].
11129044 2000 The MAK-V protein kinase regulates endocytosis in mouse.
10830953 2000 The DNA sequence of human chromosome 21.
10662544 2000 Cloning and characterization of Hunk, a novel mammalian SNF1-related protein kinase.