Property Summary

NCBI Gene PubMed Count 14
Grant Count 19
R01 Count 14
Funding $1,112,581.45
PubMed Score 24.42
PubTator Score 14.78

Knowledge Summary

Patent (9,281)

Expression

Gene RIF (6)

PMID Text
25515931 Our findings indicate that therapeutically targeting HUNK is a potential strategy for overcoming resistance and that resistant breast cancer cells maintain HUNK expression to drive tumorigenesis
21393859 Hunk is required for HER2/neu-induced mammary tumorigenesis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20133759 Data show that HUNK reconstitution in basal breast cancer cell lines prevented protein phosphatase 2-A (PP2A from binding to CFL-1.
19717424 a gene expression signature that distinguishes Hunk-wild type from Hunk-deficient tumors predicts clinical outcome in women with breast cancer
15575376 Overproduction of MAK-V/Hunk in human breast cancer may be used fore more precise molecular typing.

AA Sequence

MPAAAGDGLLGEPAAPGGGGGAEDAARPAAACEGSFLPAWVSGVPRERLRDFQHHKRVGNYLIGSRKLGE      1 - 70
GSFAKVREGLHVLTGEKVAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVM     71 - 140
ELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRAGVVHRDLKIENLLLDEDNNIKLIDFGLSNC    141 - 210
AGILGYSDPFSTQCGSPAYAAPELLARKKYGPKIDVWSIGVNMYAMLTGTLPFTVEPFSLRALYQKMVDK    211 - 280
EMNPLPTQLSTGAISFLRSLLEPDPVKRPNIQQALANRWLNENYTGKVPCNVTYPNRISLEDLSPSVVLH    281 - 350
MTEKLGYKNSDVINTVLSNRACHILAIYFLLNKKLERYLSGKSDIQDSLCYKTRLYQIEKYRAPKESYEA    351 - 420
SLDTWTRDLEFHAVQDKKPKEQEKRGDFLHRPFSKKLDKNLPSHKQPSGSLMTQIQNTKALLKDRKASKS    421 - 490
SFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVR    491 - 560
SFESVDRDDHVEVLSPSHHYRILNSPVSLARRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSP    561 - 630
PKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPV    631 - 700
NLAFDMADGVKTQC                                                            701 - 714
//

Text Mined References (15)

PMID Year Title
25515931 2015 Regulation of cell survival by HUNK mediates breast cancer resistance to HER2 inhibitors.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
21393859 2011 Hunk is required for HER2/neu-induced mammary tumorigenesis.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20133759 2010 HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1.
19890347 2010 Genome-wide association study of generalized vitiligo in an isolated European founder population identifies SMOC2, in close proximity to IDDM8.
19717424 2009 The Snf1-related kinase, Hunk, is essential for mammary tumor metastasis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
More...