Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.97
PubTator Score 3.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 7.5e-05
colon cancer 1478 2.2e-02
Disease Target Count Z-score Confidence
Velocardiofacial syndrome 46 4.105 2.1
Down syndrome 499 3.593 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.600 7.5e-05
colon cancer 2.000 2.2e-02

AA Sequence

MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSK      1 - 70
GAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEV     71 - 140
GGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK                        141 - 190
//

Text Mined References (4)

PMID Year Title