Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.97
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.600 0.000
colon cancer 2.000 0.022

AA Sequence

MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSK      1 - 70
GAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEV     71 - 140
GGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK                        141 - 190
//

Text Mined References (4)

PMID Year Title
22354841 2012 RIPPLY3 is a retinoic acid-inducible repressor required for setting the borders of the pre-placodal ectoderm.
16326386 2005 Groucho-associated transcriptional repressor ripply1 is required for proper transition from the presomitic mesoderm to somites.
10830953 2000 The DNA sequence of human chromosome 21.
10814524 2000 Isolation of two novel genes, DSCR5 and DSCR6, from Down syndrome critical region on human chromosome 21q22.2.