Property Summary

NCBI Gene PubMed Count 11
PubMed Score 60.42
PubTator Score 12.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
Down syndrome 499 1.3e-03
Multiple myeloma 1332 1.9e-03
pancreatic cancer 2398 2.6e-03
primary pancreatic ductal adenocarcinoma 1109 4.9e-03
osteosarcoma 7950 1.1e-02
lung cancer 4740 2.6e-02
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Disease Target Count Z-score Confidence
Iridogoniodysgenesis syndrome 9 4.195 2.1
Gastroparesis 22 3.972 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
Down syndrome 1.100 1.3e-03
lung cancer 1.200 2.6e-02
Multiple myeloma 1.741 1.9e-03
osteosarcoma 1.221 1.1e-02
pancreatic cancer -1.300 2.6e-03
primary pancreatic ductal adenocarcinoma -1.258 4.9e-03

Gene RIF (2)

AA Sequence

MVPRSTSLALIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGL      1 - 70
TYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISI     71 - 140
SEVNQMFFLAAKELYTKN                                                        141 - 158
//

Text Mined References (13)

PMID Year Title