Property Summary

NCBI Gene PubMed Count 0
PubMed Score 3.94

Knowledge Summary

Patent

No data available

Synonym

Accession P57053 A0AVF9 Q5R2W0
Symbols

Gene

 GO Function (1)

AA Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK                   71 - 126
//

Text Mined References (13)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16283522 2005 Inhibition of core histones acetylation by carcinogenic nickel(II).
15019208 2003 Antimicrobial polypeptides of the human colonic epithelium.
12860195 2003 Antimicrobial peptides in the first line defence of human colon mucosa.
12757711 2003 Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase.
More...