Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $37,935.1
PubMed Score 2.14
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 0.003
ependymoma -2.100 0.000
oligodendroglioma -1.400 0.017
glioblastoma -2.300 0.000
group 3 medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.800 0.001
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.800 0.000

Synonym

Accession P57052 Q6YNC2 Q8NBA1 Q8NFF6
Symbols

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

2YWK  

AA Sequence

MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALL      1 - 70
NGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFL     71 - 140
FQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSA    141 - 210
SVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKR    211 - 280
Y//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21984414 2012 The RNA recognition motif protein RBM11 is a novel tissue-specific splicing regulator.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12909339 2003 Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...