Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.14
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.200 1.7e-07
astrocytic glioma -1.700 2.7e-03
Astrocytoma, Pilocytic -1.800 4.9e-08
atypical teratoid / rhabdoid tumor -1.800 3.6e-06
ependymoma -1.900 3.6e-03
glioblastoma -2.000 6.2e-10
group 3 medulloblastoma -2.200 1.7e-05
medulloblastoma, large-cell -2.300 5.5e-05
oligodendroglioma -1.400 1.7e-02
primitive neuroectodermal tumor -1.800 9.3e-04

AA Sequence

MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALL      1 - 70
NGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFL     71 - 140
FQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSA    141 - 210
SVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKR    211 - 280
Y//

Text Mined References (13)

PMID Year Title